Citrus Sinensis ID: 025812

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------
MVVGVLALQGSFNEHIAALKRLGVKGVEIRKPDQLQNVSSLIIPGGESTTMARLAEYHNLFPALREFVKMGKPVWGTCAGLIFLANKAVGQKLGGQELVGGLDCTVHRNFFGSQIQSFEAELSVPALASQEGGPETFRGVFIRAPAVLDVGPDVDVLADYPVPSNKENAMPEKKVIVAVRQGNLLGTAFHPELTADTRWHSYFLKMMSEVGEGTSSGGKGTSSGIVVVGGENLGFNQQPKIDLPIFQ
cEEEEEEccccHHHHHHHHHHcccEEEEEccccccccccEEEEccccHHHHHHHHHHcccHHHHHHHHHccccEEEHHHHHHHHHHHHcccccccccccccEEEEEEcccccccccccccEEEcccccccccccccEEEEEEcccEEEEccccEEEEEEEEcccccccccccccEEEEEEEccEEEEEEccccccccHHHHHHHHHHHHcccccccccccccccEEEEccccccccccccccccccc
cEEEEEEcHHHHHHHHHHHHHcccEEEEEEcHHHHHHccEEEEccccHHHHHHHHHHcccHHHHHHHHHcccccEccHHHHHHHHHHHccccccccccccEEEEEEEEccccccccccccccccccccccccccccEcEEEEEccEEEEcccccEEEEEccccccHHccccccccEEEEEcccEEEEcccHcccccHHHHHHHHHHHHHHHHHHHccccccccccEEcccccccccccccccccccc
MVVGVLALQGSFNEHIAALKRLgvkgveirkpdqlqnvssliipggesttMARLAEYHNLFPALREFVkmgkpvwgtcAGLIFLANKAVgqklggqelvggldctvhrnffgsQIQSFEAelsvpalasqeggpetfrgvfirapavldvgpdvdvladypvpsnkenampeKKVIVAVRQgnllgtafhpeltadtRWHSYFLKMMSEvgegtssggkgtssgivvvggenlgfnqqpkidlpifq
MVVGVLALQGSFNEHIAALKRLGVKGveirkpdqlqnvssliipgGESTTMARLAEYHNLFPALREFVKMGKPVWGTCAGLIFLANKAVGQKLGGQELVGGLDCTVHRNFFGSQIQSFEAELSVPALASQEGGPETFRGVFIRAPAVLDVGPDVDVLADYPVpsnkenampekKVIVAVRQGNLLGTAFHPELTADTRWHSYFLKMMSEVGegtssggkgTSSGIVVVGGenlgfnqqpkidlpifq
MVVGVLALQGSFNEHIAALKRLGVKGVEIRKPDQLQNVSSLIIPGGESTTMARLAEYHNLFPALREFVKMGKPVWGTCAGLIFLANKAVGQKLGGQELVGGLDCTVHRNFFGSQIQSFEAELSVPALASQEGGPETFRGVFIRAPAVLDVGPDVDVLADYPVPSNKENAMPEKKVIVAVRQGNLLGTAFHPELTADTRWHSYFLKMMsevgegtssggkgtssgivvvggeNLGFNQQPKIDLPIFQ
**VGVLALQGSFNEHIAALKRLGVKGVEIRKPDQLQNVSSLIIPGGESTTMARLAEYHNLFPALREFVKMGKPVWGTCAGLIFLANKAVGQKLGGQELVGGLDCTVHRNFFGSQIQSFEAELSVPALA****GPETFRGVFIRAPAVLDVGPDVDVLADYPV**********KKVIVAVRQGNLLGTAFHPELTADTRWHSYFLKMM*****************IVVVGGENLGF************
MVVGVLALQGSFNEHIAALKRLGVKGVEIRKPDQLQNVSSLIIPGGESTTMARLAEYHNLFPALREFVKMGKPVWGTCAGLIFLANKA*****GGQELVGGLDCTVHRNFFGSQIQSFEAELSVPALASQEGGPETFRGVFIRAPAVLDVGPDVDVLADYPVPSNKENAMPEKKVIVAVRQGNLLGTAFHPELTADTRWHSYFLK**********************************KIDLPIFQ
MVVGVLALQGSFNEHIAALKRLGVKGVEIRKPDQLQNVSSLIIPGGESTTMARLAEYHNLFPALREFVKMGKPVWGTCAGLIFLANKAVGQKLGGQELVGGLDCTVHRNFFGSQIQSFEAELSVPALASQEGGPETFRGVFIRAPAVLDVGPDVDVLADYPVPSNKENAMPEKKVIVAVRQGNLLGTAFHPELTADTRWHSYFLKMMSEV*********GTSSGIVVVGGENLGFNQQPKIDLPIFQ
MVVGVLALQGSFNEHIAALKRLGVKGVEIRKPDQLQNVSSLIIPGGESTTMARLAEYHNLFPALREFVKMGKPVWGTCAGLIFLANKAVGQKLGGQELVGGLDCTVHRNFFGSQIQSFEAELSVPALASQEGGPETFRGVFIRAPAVLDVGPDVDVLADYPVPSNK****PEKKVIVAVRQGNLLGTAFHPELTADTRWHSYFLKMMSEVGEG**************************KIDLPIFQ
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVVGVLALQGSFNEHIAALKRLGVKGVEIRKPDQLQNVSSLIIPGGESTTMARLAEYHNLFPALREFVKMGKPVWGTCAGLIFLANKAVGQKLGGQELVGGLDCTVHRNFFGSQIQSFEAELSVPALASQEGGPETFRGVFIRAPAVLDVGPDVDVLADYPVPSNKENAMPEKKVIVAVRQGNLLGTAFHPELTADTRWHSYFLKMMSEVGEGTSSGGKGTSSGIVVVGGENLGFNQQPKIDLPIFQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query247 2.2.26 [Sep-21-2011]
Q8LAD0255 Pyridoxal biosynthesis pr yes no 0.983 0.952 0.772 1e-108
Q2RMI9188 Glutamine amidotransferas yes no 0.757 0.994 0.483 5e-47
Q5WKW1195 Glutamine amidotransferas yes no 0.761 0.964 0.488 3e-46
A5D6D2196 Glutamine amidotransferas yes no 0.777 0.979 0.466 3e-45
Q6AFB8198 Glutamine amidotransferas yes no 0.748 0.934 0.509 3e-45
B7GFL9192 Glutamine amidotransferas yes no 0.765 0.984 0.461 1e-44
C5D338192 Glutamine amidotransferas yes no 0.761 0.979 0.459 1e-44
Q5L3Y1196 Glutamine amidotransferas yes no 0.785 0.989 0.455 1e-44
Q3Z8V9195 Glutamine amidotransferas yes no 0.777 0.984 0.478 4e-44
Q04F27191 Glutamine amidotransferas yes no 0.748 0.968 0.468 7e-44
>sp|Q8LAD0|PDX2_ARATH Pyridoxal biosynthesis protein PDX2 OS=Arabidopsis thaliana GN=PDX2 PE=1 SV=1 Back     alignment and function desciption
 Score =  391 bits (1005), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 200/259 (77%), Positives = 217/259 (83%), Gaps = 16/259 (6%)

Query: 1   MVVGVLALQGSFNEHIAALKRLGVKGVEIRKPDQLQNVSSLIIPGGESTTMARLAEYHNL 60
           M VGVLALQGSFNEHIAAL+RLGV+GVEIRK DQL  VSSLIIPGGESTTMA+LAEYHNL
Sbjct: 1   MTVGVLALQGSFNEHIAALRRLGVQGVEIRKADQLLTVSSLIIPGGESTTMAKLAEYHNL 60

Query: 61  FPALREFVKMGKPVWGTCAGLIFLANKAVGQKLGGQELVGGLDCTVHRNFFGSQIQSFEA 120
           FPALREFVKMGKPVWGTCAGLIFLA++AVGQK GGQELVGGLDCTVHRNFFGSQIQSFEA
Sbjct: 61  FPALREFVKMGKPVWGTCAGLIFLADRAVGQKEGGQELVGGLDCTVHRNFFGSQIQSFEA 120

Query: 121 ELSVPALASQEGGPETFRGVFIRAPAVLDVGPDVDVLADYPVPSNK------------EN 168
           ++ VP L SQEGGPET+RGVFIRAPAVLDVGPDV+VLADYPVPSNK            E+
Sbjct: 121 DILVPQLTSQEGGPETYRGVFIRAPAVLDVGPDVEVLADYPVPSNKVLYSSSTVQIQEED 180

Query: 169 AMPEKKVIVAVRQGNLLGTAFHPELTADTRWHSYFLKMMSEVGEGTSSGGKGTSSGIVVV 228
           A+PE KVIVAV+QGNLL TAFHPELTADTRWHSYF+KM  E+ +G SS    T   IV V
Sbjct: 181 ALPETKVIVAVKQGNLLATAFHPELTADTRWHSYFIKMTKEIEQGASSSSSKT---IVSV 237

Query: 229 GGENLGFNQQPKIDLPIFQ 247
           G  + G  +  K DLPIFQ
Sbjct: 238 GETSAG-PEPAKPDLPIFQ 255
Involved in the production of pyridoxal (vitamin B6) and indirect resistance to singlet oxygen-generating photosensitizers.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 6EC: .EC: -EC: .EC: -
>sp|Q2RMI9|PDXT_MOOTA Glutamine amidotransferase subunit PdxT OS=Moorella thermoacetica (strain ATCC 39073) GN=pdxT PE=3 SV=1 Back     alignment and function description
>sp|Q5WKW1|PDXT_BACSK Glutamine amidotransferase subunit PdxT OS=Bacillus clausii (strain KSM-K16) GN=pdxT PE=3 SV=1 Back     alignment and function description
>sp|A5D6D2|PDXT_PELTS Glutamine amidotransferase subunit PdxT OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=pdxT PE=3 SV=1 Back     alignment and function description
>sp|Q6AFB8|PDXT_LEIXX Glutamine amidotransferase subunit PdxT OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=pdxT PE=3 SV=1 Back     alignment and function description
>sp|B7GFL9|PDXT_ANOFW Glutamine amidotransferase subunit PdxT OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=pdxT PE=3 SV=1 Back     alignment and function description
>sp|C5D338|PDXT_GEOSW Glutamine amidotransferase subunit PdxT OS=Geobacillus sp. (strain WCH70) GN=pdxT PE=3 SV=1 Back     alignment and function description
>sp|Q5L3Y1|PDXT_GEOKA Glutamine amidotransferase subunit PdxT OS=Geobacillus kaustophilus (strain HTA426) GN=pdxT PE=3 SV=1 Back     alignment and function description
>sp|Q3Z8V9|PDXT_DEHE1 Glutamine amidotransferase subunit PdxT OS=Dehalococcoides ethenogenes (strain 195) GN=pdxT PE=3 SV=1 Back     alignment and function description
>sp|Q04F27|PDXT_OENOB Glutamine amidotransferase subunit PdxT OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=pdxT PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query247
225435289252 PREDICTED: pyridoxal biosynthesis protei 0.971 0.952 0.779 1e-110
224104651254 predicted protein [Populus trichocarpa] 0.963 0.937 0.759 1e-107
18424366255 Pyridoxal biosynthesis protein PDX2 [Ara 0.983 0.952 0.772 1e-106
297796999255 ATPDX2/EMB2407/PDX2 [Arabidopsis lyrata 0.983 0.952 0.776 1e-106
9757756240 amidotransferase hisH-like protein [Arab 0.971 1.0 0.797 1e-105
297746243252 unnamed protein product [Vitis vinifera] 0.971 0.952 0.756 1e-105
325975749255 pyridoxial biosynthesis 2 [Arabidopsis t 0.983 0.952 0.764 1e-104
388511885253 unknown [Lotus japonicus] 0.963 0.940 0.732 1e-103
359806630254 uncharacterized protein LOC100776337 [Gl 0.971 0.944 0.724 1e-103
46399273251 putative pyridoxine biosynthesis protein 0.967 0.952 0.706 1e-102
>gi|225435289|ref|XP_002285095.1| PREDICTED: pyridoxal biosynthesis protein PDX2-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  402 bits (1033), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 202/259 (77%), Positives = 218/259 (84%), Gaps = 19/259 (7%)

Query: 1   MVVGVLALQGSFNEHIAALKRLGVKGVEIRKPDQLQNVSSLIIPGGESTTMARLAEYHNL 60
           M VGVLALQGSFNEHIAAL++LGVKGVEIRKP+QL+ V SLIIPGGESTTMA+LAEYHNL
Sbjct: 1   MAVGVLALQGSFNEHIAALRKLGVKGVEIRKPEQLEQVGSLIIPGGESTTMAKLAEYHNL 60

Query: 61  FPALREFVKMGKPVWGTCAGLIFLANKAVGQKLGGQELVGGLDCTVHRNFFGSQIQSFEA 120
           FPALREFVK+GKPVWGTCAGLIFLANKAVGQK GGQELVGGLDCTVHRNFFGSQIQSFE 
Sbjct: 61  FPALREFVKLGKPVWGTCAGLIFLANKAVGQKTGGQELVGGLDCTVHRNFFGSQIQSFET 120

Query: 121 ELSVPALASQEGGPETFRGVFIRAPAVLDVGPDVDVLADYPVPSNK------------EN 168
           +LSVP LA++EGGPETFRGVFIRAPA+L+VGP V+VLADYPVPS K            EN
Sbjct: 121 QLSVPELAAKEGGPETFRGVFIRAPAILEVGPKVEVLADYPVPSGKLFDSISALEAPQEN 180

Query: 169 AMPEKKVIVAVRQGNLLGTAFHPELTADTRWHSYFLKMMSEVGEGTSSGGKGTSSGIVVV 228
           A  EKKVIVAV+QGNLLGTAFHPELTADTRWHSYFLKM SEVGE         SS I V 
Sbjct: 181 AGSEKKVIVAVKQGNLLGTAFHPELTADTRWHSYFLKMTSEVGE-------EASSSISVA 233

Query: 229 GGENLGFNQQPKIDLPIFQ 247
           GGE+   N+Q   DLPI+Q
Sbjct: 234 GGEDTSSNEQLGNDLPIYQ 252

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224104651|ref|XP_002313515.1| predicted protein [Populus trichocarpa] gi|222849923|gb|EEE87470.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|18424366|ref|NP_568922.1| Pyridoxal biosynthesis protein PDX2 [Arabidopsis thaliana] gi|75154761|sp|Q8LAD0.1|PDX2_ARATH RecName: Full=Pyridoxal biosynthesis protein PDX2; AltName: Full=Probable glutamine amidotransferase; Short=AtPDX2; AltName: Full=Protein EMBRYO DEFECTIVE 2407 gi|21593486|gb|AAM65453.1| imidazoleglycerol-phosphate synthase subunit H-like [Arabidopsis thaliana] gi|26449721|dbj|BAC41984.1| putative imidazoleglycerol-phosphate synthase subunit H [Arabidopsis thaliana] gi|28950813|gb|AAO63330.1| At5g60540 [Arabidopsis thaliana] gi|332009958|gb|AED97341.1| Pyridoxal biosynthesis protein PDX2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297796999|ref|XP_002866384.1| ATPDX2/EMB2407/PDX2 [Arabidopsis lyrata subsp. lyrata] gi|297312219|gb|EFH42643.1| ATPDX2/EMB2407/PDX2 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|9757756|dbj|BAB08237.1| amidotransferase hisH-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297746243|emb|CBI16299.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|325975749|gb|ADZ47881.1| pyridoxial biosynthesis 2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|388511885|gb|AFK44004.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|359806630|ref|NP_001241020.1| uncharacterized protein LOC100776337 [Glycine max] gi|255639403|gb|ACU19997.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|46399273|gb|AAS92257.1| putative pyridoxine biosynthesis protein [Nicotiana tabacum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query247
TAIR|locus:2175083255 PDX2 "pyridoxine biosynthesis 0.983 0.952 0.737 1e-93
ASPGD|ASPL0000007180271 AN6141 [Emericella nidulans (t 0.623 0.568 0.494 6.7e-43
UNIPROTKB|G4N4K4246 MGG_05981 "Glutamine amidotran 0.821 0.825 0.473 5.9e-41
DICTYBASE|DDB_G0288305248 pdx2 "putative pyridoxal biosy 0.680 0.677 0.447 6.3e-37
POMBASE|SPAC222.08c234 SPAC222.08c "glutamine aminotr 0.789 0.833 0.418 4e-35
CGD|CAL0006041249 SNO1 [Candida albicans (taxid: 0.809 0.803 0.415 8.5e-33
UNIPROTKB|Q5AJ35249 SNO1 "Putative uncharacterized 0.809 0.803 0.415 8.5e-33
UNIPROTKB|Q3Z8V9195 pdxT "Glutamine amidotransfera 0.627 0.794 0.496 1.8e-32
TIGR_CMR|DET_0598195 DET_0598 "SNO glutamine amidot 0.627 0.794 0.496 1.8e-32
TIGR_CMR|CHY_2702191 CHY_2702 "glutamine amidotrans 0.655 0.848 0.456 2.3e-32
TAIR|locus:2175083 PDX2 "pyridoxine biosynthesis 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 933 (333.5 bits), Expect = 1.0e-93, P = 1.0e-93
 Identities = 191/259 (73%), Positives = 206/259 (79%)

Query:     1 MVVGVLALQGSFNEHIAALKRLGVKGVEIRKPDQLQNVSSLIIPGGESTTMARLAEYHNL 60
             M VGVLALQGSFNEHIAAL+RLGV+GVEIRK DQL  VSSLIIPGGESTTMA+LAEYHNL
Sbjct:     1 MTVGVLALQGSFNEHIAALRRLGVQGVEIRKADQLLTVSSLIIPGGESTTMAKLAEYHNL 60

Query:    61 FPALREFVKMGKPVWGTCAGLIFLANKAVGQKLGGQELVGGLDCTVHRNFFGSQIQSFEA 120
             FPALREFVKMGKPVWGTCAGLIFLA++AVGQK GGQELVGGLDCTVHRNFFGSQIQSFEA
Sbjct:    61 FPALREFVKMGKPVWGTCAGLIFLADRAVGQKEGGQELVGGLDCTVHRNFFGSQIQSFEA 120

Query:   121 ELSVPALASQEGGPETFRGVFIRAPAVLDVGPDVDVLADYPVPSNK------------EN 168
             ++ VP L SQEGGPET+RGVFIRAPAVLDVGPDV+VLADYPVPSNK            E+
Sbjct:   121 DILVPQLTSQEGGPETYRGVFIRAPAVLDVGPDVEVLADYPVPSNKVLYSSSTVQIQEED 180

Query:   169 AMPEKKVIVAVRQGNLLGTAFHPELTADTRWHSYFLKMMXXXXXXXXXXXXXXXXXXXXX 228
             A+PE KVIVAV+QGNLL TAFHPELTADTRWHSYF+KM                      
Sbjct:   181 ALPETKVIVAVKQGNLLATAFHPELTADTRWHSYFIKM---TKEIEQGASSSSSKTIVSV 237

Query:   229 XXXNLGFNQQPKIDLPIFQ 247
                + G  +  K DLPIFQ
Sbjct:   238 GETSAG-PEPAKPDLPIFQ 255
GO:0005737 "cytoplasm" evidence=ISM
GO:0008615 "pyridoxine biosynthetic process" evidence=ISS
GO:0009793 "embryo development ending in seed dormancy" evidence=NAS
GO:0004359 "glutaminase activity" evidence=ISS;IDA
GO:0005829 "cytosol" evidence=IDA
GO:0042819 "vitamin B6 biosynthetic process" evidence=IGI;RCA;IMP
GO:0046982 "protein heterodimerization activity" evidence=IPI
ASPGD|ASPL0000007180 AN6141 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|G4N4K4 MGG_05981 "Glutamine amidotransferase subunit pdxT" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0288305 pdx2 "putative pyridoxal biosynthesis protein PDX2" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
POMBASE|SPAC222.08c SPAC222.08c "glutamine aminotransferase subunit (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
CGD|CAL0006041 SNO1 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q5AJ35 SNO1 "Putative uncharacterized protein SNO1" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
UNIPROTKB|Q3Z8V9 pdxT "Glutamine amidotransferase subunit PdxT" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
TIGR_CMR|DET_0598 DET_0598 "SNO glutamine amidotransferase family" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_2702 CHY_2702 "glutamine amidotransferase, SNO family" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q0S1D2PDXT_RHOSR2, ., 6, ., -, ., -0.44490.80160.9801yesno
Q6AFB8PDXT_LEIXX2, ., 6, ., -, ., -0.50990.74890.9343yesno
Q8LAD0PDX2_ARATH2, ., 6, ., -, ., -0.77220.98380.9529yesno
A0LUK9PDXT_ACIC12, ., 6, ., -, ., -0.50480.78130.9323yesno
C1B4C5PDXT_RHOOB2, ., 6, ., -, ., -0.44010.80160.9801yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_Genewise1_v1.C_LG_IX4777
glutaminase (EC-3.5.1.2) (255 aa)
(Populus trichocarpa)
Predicted Functional Partners:
eugene3.00161108
hypothetical protein (309 aa)
• ••• • 0.991
eugene3.00060871
hypothetical protein (309 aa)
• ••• • 0.991
eugene3.00011281
hypothetical protein (306 aa)
• ••• • 0.986
fgenesh4_pg.C_LG_II002252
pyridoxal kinase (EC-2.7.1.35) (325 aa)
•    •• 0.953
eugene3.00061707
hypothetical protein (292 aa)
•     • 0.745
gw1.XI.2542.1
hypothetical protein (325 aa)
      • 0.628
gw1.I.445.1
hypothetical protein (430 aa)
•     • 0.621
fgenesh4_pg.C_LG_II002417
pantoate-beta-alanine ligase (EC-6.3.2.1) (319 aa)
      • 0.620
fgenesh4_pm.C_LG_X000986
hypothetical protein (932 aa)
•       0.587
fgenesh4_pg.C_LG_III001465
hypothetical protein (280 aa)
      • 0.575

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query247
PLN02832248 PLN02832, PLN02832, glutamine amidotransferase sub 1e-155
cd01749183 cd01749, GATase1_PB, Glutamine Amidotransferase (G 1e-103
PRK13525189 PRK13525, PRK13525, glutamine amidotransferase sub 6e-94
COG0311194 COG0311, PDX2, Predicted glutamine amidotransferas 8e-87
PRK13527200 PRK13527, PRK13527, glutamine amidotransferase sub 2e-81
TIGR03800184 TIGR03800, PLP_synth_Pdx2, pyridoxal 5'-phosphate 4e-70
pfam01174188 pfam01174, SNO, SNO glutamine amidotransferase fam 1e-55
PRK13526179 PRK13526, PRK13526, glutamine amidotransferase sub 2e-40
PRK13181199 PRK13181, hisH, imidazole glycerol phosphate synth 4e-08
cd01748198 cd01748, GATase1_IGP_Synthase, Type 1 glutamine am 4e-08
cd0312892 cd03128, GAT_1, Type 1 glutamine amidotransferase 2e-07
cd01653115 cd01653, GATase1, Type 1 glutamine amidotransferas 4e-07
COG0118204 COG0118, HisH, Glutamine amidotransferase [Amino a 8e-07
cd03130198 cd03130, GATase1_CobB, Type 1 glutamine amidotrans 1e-06
TIGR01855196 TIGR01855, IMP_synth_hisH, imidazole glycerol phos 8e-06
PRK13141205 PRK13141, hisH, imidazole glycerol phosphate synth 1e-05
PLN02617 538 PLN02617, PLN02617, imidazole glycerol phosphate s 3e-05
pfam07685157 pfam07685, GATase_3, CobB/CobQ-like glutamine amid 5e-05
cd03140170 cd03140, GATase1_PfpI_3, Type 1 glutamine amidotra 3e-04
TIGR01737227 TIGR01737, FGAM_synth_I, phosphoribosylformylglyci 3e-04
PRK01175261 PRK01175, PRK01175, phosphoribosylformylglycinamid 4e-04
PRK01077451 PRK01077, PRK01077, cobyrinic acid a,c-diamide syn 7e-04
COG1797451 COG1797, CobB, Cobyrinic acid a,c-diamide synthase 0.001
PRK13152201 PRK13152, hisH, imidazole glycerol phosphate synth 0.002
>gnl|CDD|215446 PLN02832, PLN02832, glutamine amidotransferase subunit of pyridoxal 5'-phosphate synthase complex Back     alignment and domain information 
 Score =  431 bits (1111), Expect = e-155
 Identities = 180/253 (71%), Positives = 202/253 (79%), Gaps = 12/253 (4%)

Query: 1   MVVGVLALQGSFNEHIAALKRLGVKGVEIRKPDQLQNVSSLIIPGGESTTMARLAEYHNL 60
           M +GVLALQGSFNEHIAAL+RLGV+ VE+RKP+QL+ VS LIIPGGESTTMA+LAE HNL
Sbjct: 2   MAIGVLALQGSFNEHIAALRRLGVEAVEVRKPEQLEGVSGLIIPGGESTTMAKLAERHNL 61

Query: 61  FPALREFVKMGKPVWGTCAGLIFLANKAVGQKLGGQELVGGLDCTVHRNFFGSQIQSFEA 120
           FPALREFVK GKPVWGTCAGLIFLA +AVGQK GGQEL+GGLDCTVHRNFFGSQI SFE 
Sbjct: 62  FPALREFVKSGKPVWGTCAGLIFLAERAVGQKEGGQELLGGLDCTVHRNFFGSQINSFET 121

Query: 121 ELSVPALASQEGGPETFRGVFIRAPAVLDVGPDVDVLADYPVPSNK------ENAMPEKK 174
           EL VP LA+ EGGPETFR VFIRAPA+L VGP V+VLA+YP+PS K       +A    K
Sbjct: 122 ELPVPELAASEGGPETFRAVFIRAPAILSVGPGVEVLAEYPLPSEKALYSSSTDAEGRDK 181

Query: 175 VIVAVRQGNLLGTAFHPELTADTRWHSYFLKMMSEVGEGTSSGGKGTSSGIVVVGGENLG 234
           VIVAV+QGNLL TAFHPELTADTRWHSYF+KM+SE  E  S      SS + V   +   
Sbjct: 182 VIVAVKQGNLLATAFHPELTADTRWHSYFVKMVSESEEYAS------SSELAVAKVDESS 235

Query: 235 FNQQPKIDLPIFQ 247
            + +P  DLPIFQ
Sbjct: 236 ISLEPPKDLPIFQ 248

Length = 248
>gnl|CDD|153220 cd01749, GATase1_PB, Glutamine Amidotransferase (GATase_I) involved in pyridoxine biosynthesis Back     alignment and domain information
>gnl|CDD|237411 PRK13525, PRK13525, glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>gnl|CDD|223388 COG0311, PDX2, Predicted glutamine amidotransferase involved in pyridoxine biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|237412 PRK13527, PRK13527, glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>gnl|CDD|163512 TIGR03800, PLP_synth_Pdx2, pyridoxal 5'-phosphate synthase, glutaminase subunit Pdx2 Back     alignment and domain information
>gnl|CDD|201639 pfam01174, SNO, SNO glutamine amidotransferase family Back     alignment and domain information
>gnl|CDD|184113 PRK13526, PRK13526, glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>gnl|CDD|183878 PRK13181, hisH, imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>gnl|CDD|153219 cd01748, GATase1_IGP_Synthase, Type 1 glutamine amidotransferase (GATase1) domain found in imidazole glycerol phosphate synthase (IGPS) Back     alignment and domain information
>gnl|CDD|153222 cd03128, GAT_1, Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>gnl|CDD|153210 cd01653, GATase1, Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>gnl|CDD|223196 COG0118, HisH, Glutamine amidotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|153224 cd03130, GATase1_CobB, Type 1 glutamine amidotransferase (GATase1) domain found in Cobyrinic Acid a,c-Diamide Synthase Back     alignment and domain information
>gnl|CDD|233601 TIGR01855, IMP_synth_hisH, imidazole glycerol phosphate synthase, glutamine amidotransferase subunit Back     alignment and domain information
>gnl|CDD|237288 PRK13141, hisH, imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>gnl|CDD|178226 PLN02617, PLN02617, imidazole glycerol phosphate synthase hisHF Back     alignment and domain information
>gnl|CDD|219513 pfam07685, GATase_3, CobB/CobQ-like glutamine amidotransferase domain Back     alignment and domain information
>gnl|CDD|153234 cd03140, GATase1_PfpI_3, Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus Back     alignment and domain information
>gnl|CDD|233553 TIGR01737, FGAM_synth_I, phosphoribosylformylglycinamidine synthase I Back     alignment and domain information
>gnl|CDD|234913 PRK01175, PRK01175, phosphoribosylformylglycinamidine synthase I; Provisional Back     alignment and domain information
>gnl|CDD|234896 PRK01077, PRK01077, cobyrinic acid a,c-diamide synthase; Validated Back     alignment and domain information
>gnl|CDD|224710 COG1797, CobB, Cobyrinic acid a,c-diamide synthase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|171876 PRK13152, hisH, imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 247
PLN02832248 glutamine amidotransferase subunit of pyridoxal 5' 100.0
COG0118204 HisH Glutamine amidotransferase [Amino acid transp 100.0
PRK13142192 hisH imidazole glycerol phosphate synthase subunit 100.0
CHL00188210 hisH imidazole glycerol phosphate synthase subunit 100.0
PRK14004210 hisH imidazole glycerol phosphate synthase subunit 100.0
PRK13170196 hisH imidazole glycerol phosphate synthase subunit 100.0
COG0311194 PDX2 Predicted glutamine amidotransferase involved 100.0
PRK13526179 glutamine amidotransferase subunit PdxT; Provision 100.0
PRK13146209 hisH imidazole glycerol phosphate synthase subunit 100.0
PF01174188 SNO: SNO glutamine amidotransferase family; InterP 100.0
PRK13181199 hisH imidazole glycerol phosphate synthase subunit 99.98
PRK13525189 glutamine amidotransferase subunit PdxT; Provision 99.98
PRK13152201 hisH imidazole glycerol phosphate synthase subunit 99.98
TIGR03800184 PLP_synth_Pdx2 pyridoxal 5'-phosphate synthase, gl 99.98
PRK13143200 hisH imidazole glycerol phosphate synthase subunit 99.97
cd01749183 GATase1_PB Glutamine Amidotransferase (GATase_I) i 99.97
PLN02617 538 imidazole glycerol phosphate synthase hisHF 99.97
cd01748198 GATase1_IGP_Synthase Type 1 glutamine amidotransfe 99.96
TIGR01855196 IMP_synth_hisH imidazole glycerol phosphate syntha 99.96
PRK13141205 hisH imidazole glycerol phosphate synthase subunit 99.96
KOG0623 541 consensus Glutamine amidotransferase/cyclase [Amin 99.96
PRK13527200 glutamine amidotransferase subunit PdxT; Provision 99.96
PRK06895190 putative anthranilate synthase component II; Provi 99.94
COG0512191 PabA Anthranilate/para-aminobenzoate synthases com 99.93
TIGR00888188 guaA_Nterm GMP synthase (glutamine-hydrolyzing), N 99.91
PRK00758184 GMP synthase subunit A; Validated 99.91
cd01742181 GATase1_GMP_Synthase Type 1 glutamine amidotransfe 99.9
KOG3210226 consensus Imidazoleglycerol-phosphate synthase sub 99.9
PRK06774191 para-aminobenzoate synthase component II; Provisio 99.9
CHL00101190 trpG anthranilate synthase component 2 99.89
PRK07649195 para-aminobenzoate/anthranilate synthase glutamine 99.89
PRK07765214 para-aminobenzoate synthase component II; Provisio 99.89
PRK05670189 anthranilate synthase component II; Provisional 99.89
PRK08007187 para-aminobenzoate synthase component II; Provisio 99.89
PRK06490239 glutamine amidotransferase; Provisional 99.89
PLN02347 536 GMP synthetase 99.88
cd01743184 GATase1_Anthranilate_Synthase Type 1 glutamine ami 99.88
COG0518198 GuaA GMP synthase - Glutamine amidotransferase dom 99.88
TIGR00566188 trpG_papA glutamine amidotransferase of anthranila 99.87
PLN02335222 anthranilate synthase 99.87
PRK05637208 anthranilate synthase component II; Provisional 99.87
PF00117192 GATase: Glutamine amidotransferase class-I; InterP 99.87
PRK08250235 glutamine amidotransferase; Provisional 99.87
TIGR01815717 TrpE-clade3 anthranilate synthase, alpha proteobac 99.87
PRK07053234 glutamine amidotransferase; Provisional 99.86
PRK00074 511 guaA GMP synthase; Reviewed 99.86
PRK08857193 para-aminobenzoate synthase component II; Provisio 99.86
cd03130198 GATase1_CobB Type 1 glutamine amidotransferase (GA 99.85
PRK09065237 glutamine amidotransferase; Provisional 99.85
PRK05665240 amidotransferase; Provisional 99.84
PRK09522 531 bifunctional glutamine amidotransferase/anthranila 99.84
PRK13566720 anthranilate synthase; Provisional 99.84
TIGR01737227 FGAM_synth_I phosphoribosylformylglycinamidine syn 99.83
cd01741188 GATase1_1 Subgroup of proteins having the Type 1 g 99.82
PLN02889 918 oxo-acid-lyase/anthranilate synthase 99.81
cd01744178 GATase1_CPSase Small chain of the glutamine-depend 99.81
PRK03619219 phosphoribosylformylglycinamidine synthase I; Prov 99.8
TIGR01823 742 PabB-fungal aminodeoxychorismate synthase, fungal 99.8
PRK12838354 carbamoyl phosphate synthase small subunit; Review 99.8
TIGR01368358 CPSaseIIsmall carbamoyl-phosphate synthase, small 99.8
PRK07567242 glutamine amidotransferase; Provisional 99.8
CHL00197382 carA carbamoyl-phosphate synthase arginine-specifi 99.79
COG1797451 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme 99.79
PRK12564360 carbamoyl phosphate synthase small subunit; Review 99.79
cd01750194 GATase1_CobQ Type 1 glutamine amidotransferase (GA 99.78
PRK14607 534 bifunctional glutamine amidotransferase/anthranila 99.77
COG0505368 CarA Carbamoylphosphate synthase small subunit [Am 99.76
cd01747273 GATase1_Glutamyl_Hydrolase Type 1 glutamine amidot 99.75
TIGR00379449 cobB cobyrinic acid a,c-diamide synthase. This mod 99.75
cd01745189 GATase1_2 Subgroup of proteins having the Type 1 g 99.74
COG0047231 PurL Phosphoribosylformylglycinamidine (FGAM) synt 99.74
PRK00784488 cobyric acid synthase; Provisional 99.73
PRK01077451 cobyrinic acid a,c-diamide synthase; Validated 99.72
PLN02771415 carbamoyl-phosphate synthase (glutamine-hydrolyzin 99.72
PRK13896433 cobyrinic acid a,c-diamide synthase; Provisional 99.7
PRK01175261 phosphoribosylformylglycinamidine synthase I; Prov 99.7
PRK11366254 puuD gamma-glutamyl-gamma-aminobutyrate hydrolase; 99.69
PRK06186229 hypothetical protein; Validated 99.66
COG2071243 Predicted glutamine amidotransferases [General fun 99.63
KOG0026223 consensus Anthranilate synthase, beta chain [Amino 99.63
PRK06278 476 cobyrinic acid a,c-diamide synthase; Validated 99.62
PRK05380533 pyrG CTP synthetase; Validated 99.6
PF07685158 GATase_3: CobB/CobQ-like glutamine amidotransferas 99.58
TIGR00313475 cobQ cobyric acid synthase CobQ. 99.57
cd01740238 GATase1_FGAR_AT Type 1 glutamine amidotransferase 99.56
TIGR00337525 PyrG CTP synthase. CTP synthase is involved in pyr 99.55
PF07722217 Peptidase_C26: Peptidase C26; InterPro: IPR011697 99.54
PF13507259 GATase_5: CobB/CobQ-like glutamine amidotransferas 99.53
PLN02327557 CTP synthase 99.5
COG0504533 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide 99.49
KOG1622 552 consensus GMP synthase [Nucleotide transport and m 99.47
cd01746235 GATase1_CTP_Synthase Type 1 glutamine amidotransfe 99.45
KOG0370 1435 consensus Multifunctional pyrimidine synthesis pro 99.43
KOG3179245 consensus Predicted glutamine synthetase [Nucleoti 99.39
PRK05368302 homoserine O-succinyltransferase; Provisional 99.37
COG3442250 Predicted glutamine amidotransferase [General func 99.31
KOG1224 767 consensus Para-aminobenzoate (PABA) synthase ABZ1 99.3
COG1492486 CobQ Cobyric acid synthase [Coenzyme metabolism] 99.3
TIGR018571239 FGAM-synthase phosphoribosylformylglycinamidine sy 99.28
PF09825367 BPL_N: Biotin-protein ligase, N terminal; InterPro 99.24
KOG2387585 consensus CTP synthase (UTP-ammonia lyase) [Nucleo 99.19
cd03146212 GAT1_Peptidase_E Type 1 glutamine amidotransferase 99.11
PLN032061307 phosphoribosylformylglycinamidine synthase; Provis 99.08
TIGR017351310 FGAM_synt phosphoribosylformylglycinamidine syntha 99.06
PRK052971290 phosphoribosylformylglycinamidine synthase; Provis 98.96
KOG1559340 consensus Gamma-glutamyl hydrolase [Coenzyme trans 98.87
PHA033661304 FGAM-synthase; Provisional 98.84
cd03144114 GATase1_ScBLP_like Type 1 glutamine amidotransfera 98.81
PRK05282233 (alpha)-aspartyl dipeptidase; Validated 98.7
TIGR01382166 PfpI intracellular protease, PfpI family. The memb 98.67
TIGR017391202 tegu_FGAM_synt herpesvirus tegument protein/v-FGAM 98.66
PRK11780217 isoprenoid biosynthesis protein with amidotransfer 98.62
cd03134165 GATase1_PfpI_like A type 1 glutamine amidotransfer 98.59
cd03169180 GATase1_PfpI_1 Type 1 glutamine amidotransferase ( 98.55
cd03132142 GATase1_catalase Type 1 glutamine amidotransferase 98.53
cd01653115 GATase1 Type 1 glutamine amidotransferase (GATase1 98.5
COG4285253 Uncharacterized conserved protein [Function unknow 98.43
cd03135163 GATase1_DJ-1 Type 1 glutamine amidotransferase (GA 98.41
COG0693188 ThiJ Putative intracellular protease/amidase [Gene 98.38
cd0312892 GAT_1 Type 1 glutamine amidotransferase (GATase1)- 98.33
TIGR01383179 not_thiJ DJ-1 family protein. This model represent 98.32
cd03129210 GAT1_Peptidase_E_like Type 1 glutamine amidotransf 98.25
cd03137187 GATase1_AraC_1 AraC transcriptional regulators hav 98.21
PRK11574196 oxidative-stress-resistance chaperone; Provisional 98.21
cd03138195 GATase1_AraC_2 AraC transcriptional regulators hav 98.14
cd03133213 GATase1_ES1 Type 1 glutamine amidotransferase (GAT 98.13
cd03140170 GATase1_PfpI_3 Type 1 glutamine amidotransferase ( 98.13
cd03147231 GATase1_Ydr533c_like Type 1 glutamine amidotransfe 98.12
cd03139183 GATase1_PfpI_2 Type 1 glutamine amidotransferase ( 98.11
PRK11249752 katE hydroperoxidase II; Provisional 98.05
cd03136185 GATase1_AraC_ArgR_like AraC transcriptional regula 98.01
PRK04155287 chaperone protein HchA; Provisional 98.01
cd03148232 GATase1_EcHsp31_like Type 1 glutamine amidotransfe 97.96
PF01965147 DJ-1_PfpI: DJ-1/PfpI family; InterPro: IPR002818 T 97.65
PF04204298 HTS: Homoserine O-succinyltransferase ; InterPro: 97.63
cd03141221 GATase1_Hsp31_like Type 1 glutamine amidotransfera 97.61
PF03575154 Peptidase_S51: Peptidase family S51; InterPro: IPR 97.6
PRK09393322 ftrA transcriptional activator FtrA; Provisional 97.53
PF13278166 DUF4066: Putative amidotransferase; PDB: 3BHN_A 3M 97.49
cd03131175 GATase1_HTS Type 1 glutamine amidotransferase (GAT 97.42
KOG2764247 consensus Putative transcriptional regulator DJ-1 97.18
TIGR01001300 metA homoserine O-succinyltransferase. The apparen 97.09
cd03145217 GAT1_cyanophycinase Type 1 glutamine amidotransfer 97.01
TIGR02069250 cyanophycinase cyanophycinase. This model describe 96.9
PF0369880 UPF0180: Uncharacterised protein family (UPF0180); 96.66
COG3340224 PepE Peptidase E [Amino acid transport and metabol 96.51
PRK0309480 hypothetical protein; Provisional 96.36
KOG19071320 consensus Phosphoribosylformylglycinamidine syntha 95.58
COG4977328 Transcriptional regulator containing an amidase do 95.3
PRK01911292 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 94.73
COG3155217 ElbB Uncharacterized protein involved in an early 94.32
PRK03708277 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 94.25
PRK02649305 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 92.82
PF06283217 ThuA: Trehalose utilisation; PDB: 4E5V_A 1T0B_A. 91.95
COG4635175 HemG Flavodoxin [Energy production and conversion 91.21
PRK14077287 pnk inorganic polyphosphate/ATP-NAD kinase; Provis 91.0
PRK11104177 hemG protoporphyrinogen oxidase; Provisional 90.77
PRK04539296 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 90.7
cd03143154 A4_beta-galactosidase_middle_domain A4 beta-galact 90.55
PRK04885265 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 90.51
PRK03378292 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 90.45
PRK03372306 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 90.19
PRK02155291 ppnK NAD(+)/NADH kinase family protein; Provisiona 90.0
PF08532207 Glyco_hydro_42M: Beta-galactosidase trimerisation 89.43
PRK14075256 pnk inorganic polyphosphate/ATP-NAD kinase; Provis 89.42
PRK14076569 pnk inorganic polyphosphate/ATP-NAD kinase; Provis 89.32
PRK02645305 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 88.81
COG2910211 Putative NADH-flavin reductase [General function p 88.15
COG4090154 Uncharacterized protein conserved in archaea [Func 84.8
COG4242293 CphB Cyanophycinase and related exopeptidases [Sec 84.74
PRK01185271 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 84.64
PRK09271160 flavodoxin; Provisional 84.51
COG0771 448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas 84.11
PRK01231295 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 83.69
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 82.79
PRK00561259 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 81.28
PF0919838 T4-Gluco-transf: Bacteriophage T4 beta-glucosyltra 80.51
>PLN02832 glutamine amidotransferase subunit of pyridoxal 5'-phosphate synthase complex Back     alignment and domain information 
Probab=100.00  E-value=8.6e-46  Score=320.35  Aligned_cols=241  Identities=74%  Similarity=1.176  Sum_probs=202.5

Q ss_pred             CEEEEEecCCChHHHHHHHHhCCCeEEEECCccCCCCCCEEEECCCchhHHHHHHhhCCHHHHHHHHHHcCCcEEEEehh
Q 025812            1 MVVGVLALQGSFNEHIAALKRLGVKGVEIRKPDQLQNVSSLIIPGGESTTMARLAEYHNLFPALREFVKMGKPVWGTCAG   80 (247)
Q Consensus         1 m~I~vl~~~G~~~~~~~~L~~~G~~v~~~~~~~~l~~~d~lilpGG~~~~~~~l~~~~~~~~~i~~~~~~g~PilGIC~G   80 (247)
                      |||+||+++|++.++.++|+++|++++++++++++.++|+||||||+++.+..|.+..++.+.|++++++|+|+||||+|
T Consensus         2 m~igVLa~qG~~~e~~~aL~~lG~ev~~v~~~~~L~~~DgLILPGGfs~~~~~L~~~~gl~~~I~~~v~~g~PvLGiC~G   81 (248)
T PLN02832          2 MAIGVLALQGSFNEHIAALRRLGVEAVEVRKPEQLEGVSGLIIPGGESTTMAKLAERHNLFPALREFVKSGKPVWGTCAG   81 (248)
T ss_pred             cEEEEEeCCCchHHHHHHHHHCCCcEEEeCCHHHhccCCEEEeCCCHHHHHHHHHhhcchHHHHHHHHHcCCCEEEEChh
Confidence            79999999999999999999999999999999999999999999999988888876557899999999999999999999


Q ss_pred             HHHHHHhhhcccCCCcccccceeeEEEeeccCCccccccccccCCcccccCCCCcceeeeeecCceeeecCCCeEEEEEE
Q 025812           81 LIFLANKAVGQKLGGQELVGGLDCTVHRNFFGSQIQSFEAELSVPALASQEGGPETFRGVFIRAPAVLDVGPDVDVLADY  160 (247)
Q Consensus        81 ~QlL~~~~~~~~~g~~~~LG~l~g~v~~~~~g~~~~~~~~~~~v~~~Gw~~~~~~~~~~~~~~~~l~~~l~~~~~~~hs~  160 (247)
                      ||+|++.+++...++.+++|.++.+|.||.+|+++.||...+++|++||+.+.+..++++|.+.|.+....+++||+|||
T Consensus        82 mqlLa~~~~~~~~~~~~~lg~Ldi~v~RN~~g~qv~sfe~~l~ip~~gwn~~~~~~~~~vFirap~i~~~~~~v~~l~sy  161 (248)
T PLN02832         82 LIFLAERAVGQKEGGQELLGGLDCTVHRNFFGSQINSFETELPVPELAASEGGPETFRAVFIRAPAILSVGPGVEVLAEY  161 (248)
T ss_pred             HHHHHHHhcccccCCcceeCCccceEEecccCceeEeEEcCCcCCccccccccccccceEEecCCceEeCCCcEEEEEEe
Confidence            99999998653223456799999999999999999999777899999999875445778888888876667889999999


Q ss_pred             eCCCCC-----CCCCCCC-cEEEEEeeCCEEEEeeCCCCCCchHHHHHHHHHHHhcccCccCCCCCccceeEEEcccccC
Q 025812          161 PVPSNK-----ENAMPEK-KVIVAVRQGNLLGTAFHPELTADTRWHSYFLKMMSEVGEGTSSGGKGTSSGIVVVGGENLG  234 (247)
Q Consensus       161 ~~~~~~-----~~~~~~~-~~~~~~~~~~i~gvQFHPE~s~~~~i~~nfl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  234 (247)
                      ..+...     ++++|+. .++++++++|++|+|||||+|++.+|++||++++....+-.+++      -..|.-=..-.
T Consensus       162 ~~~~~~~~~~~a~~~y~~~~~~~aV~qgnvlatqFHPEls~d~rih~~Fl~~~~~~~~~~~~~------~~~~~~~~~~~  235 (248)
T PLN02832        162 PLPSEKALYSSSTDAEGRDKVIVAVKQGNLLATAFHPELTADTRWHSYFVKMVSESEEYASSS------ELAVAKVDESS  235 (248)
T ss_pred             cccccccccccccccccCCceEEEEEeCCEEEEEccCccCCccHHHHHHHHHHHHhhhccccc------ccccccccccc
Confidence            865432     3566765 78999999999999999999999999999999998766665554      22222222334


Q ss_pred             CCCCCcCCCCCCC
Q 025812          235 FNQQPKIDLPIFQ  247 (247)
Q Consensus       235 ~~~~~~~~~~~~~  247 (247)
                      ..-.|.-||||||
T Consensus       236 ~~~~~~~~~~~~~  248 (248)
T PLN02832        236 ISLEPPKDLPIFQ  248 (248)
T ss_pred             ccccCcccCCCcC
Confidence            4557888999998

>COG0118 HisH Glutamine amidotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13142 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>CHL00188 hisH imidazole glycerol phosphate synthase subunit hisH; Provisional Back     alignment and domain information
>PRK14004 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK13170 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>COG0311 PDX2 Predicted glutamine amidotransferase involved in pyridoxine biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK13526 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>PRK13146 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PF01174 SNO: SNO glutamine amidotransferase family; InterPro: IPR002161 Members of this family are involved in the pyridoxine biosynthetic pathway [, ] Back     alignment and domain information
>PRK13181 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK13525 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>PRK13152 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>TIGR03800 PLP_synth_Pdx2 pyridoxal 5'-phosphate synthase, glutaminase subunit Pdx2 Back     alignment and domain information
>PRK13143 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>cd01749 GATase1_PB Glutamine Amidotransferase (GATase_I) involved in pyridoxine biosynthesis Back     alignment and domain information
>PLN02617 imidazole glycerol phosphate synthase hisHF Back     alignment and domain information
>cd01748 GATase1_IGP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in imidazole glycerol phosphate synthase (IGPS) Back     alignment and domain information
>TIGR01855 IMP_synth_hisH imidazole glycerol phosphate synthase, glutamine amidotransferase subunit Back     alignment and domain information
>PRK13141 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>KOG0623 consensus Glutamine amidotransferase/cyclase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13527 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>PRK06895 putative anthranilate synthase component II; Provisional Back     alignment and domain information
>COG0512 PabA Anthranilate/para-aminobenzoate synthases component II [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>TIGR00888 guaA_Nterm GMP synthase (glutamine-hydrolyzing), N-terminal domain or A subunit Back     alignment and domain information
>PRK00758 GMP synthase subunit A; Validated Back     alignment and domain information
>cd01742 GATase1_GMP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in GMP synthetase Back     alignment and domain information
>KOG3210 consensus Imidazoleglycerol-phosphate synthase subunit H-like [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK06774 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>CHL00101 trpG anthranilate synthase component 2 Back     alignment and domain information
>PRK07649 para-aminobenzoate/anthranilate synthase glutamine amidotransferase component II; Validated Back     alignment and domain information
>PRK07765 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>PRK05670 anthranilate synthase component II; Provisional Back     alignment and domain information
>PRK08007 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>PRK06490 glutamine amidotransferase; Provisional Back     alignment and domain information
>PLN02347 GMP synthetase Back     alignment and domain information
>cd01743 GATase1_Anthranilate_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in Anthranilate synthase Back     alignment and domain information
>COG0518 GuaA GMP synthase - Glutamine amidotransferase domain [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00566 trpG_papA glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase Back     alignment and domain information
>PLN02335 anthranilate synthase Back     alignment and domain information
>PRK05637 anthranilate synthase component II; Provisional Back     alignment and domain information
>PF00117 GATase: Glutamine amidotransferase class-I; InterPro: IPR017926 Glutamine amidotransferase (GATase) enzymes catalyse the removal of the ammonia group from glutamine and then transfer this group to a substrate to form a new carbon-nitrogen group [] Back     alignment and domain information
>PRK08250 glutamine amidotransferase; Provisional Back     alignment and domain information
>TIGR01815 TrpE-clade3 anthranilate synthase, alpha proteobacterial clade Back     alignment and domain information
>PRK07053 glutamine amidotransferase; Provisional Back     alignment and domain information
>PRK00074 guaA GMP synthase; Reviewed Back     alignment and domain information
>PRK08857 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>cd03130 GATase1_CobB Type 1 glutamine amidotransferase (GATase1) domain found in Cobyrinic Acid a,c-Diamide Synthase Back     alignment and domain information
>PRK09065 glutamine amidotransferase; Provisional Back     alignment and domain information
>PRK05665 amidotransferase; Provisional Back     alignment and domain information
>PRK09522 bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK13566 anthranilate synthase; Provisional Back     alignment and domain information
>TIGR01737 FGAM_synth_I phosphoribosylformylglycinamidine synthase I Back     alignment and domain information
>cd01741 GATase1_1 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information
>PLN02889 oxo-acid-lyase/anthranilate synthase Back     alignment and domain information
>cd01744 GATase1_CPSase Small chain of the glutamine-dependent form of carbamoyl phosphate synthase, CPSase II Back     alignment and domain information
>PRK03619 phosphoribosylformylglycinamidine synthase I; Provisional Back     alignment and domain information
>TIGR01823 PabB-fungal aminodeoxychorismate synthase, fungal clade Back     alignment and domain information
>PRK12838 carbamoyl phosphate synthase small subunit; Reviewed Back     alignment and domain information
>TIGR01368 CPSaseIIsmall carbamoyl-phosphate synthase, small subunit Back     alignment and domain information
>PRK07567 glutamine amidotransferase; Provisional Back     alignment and domain information
>CHL00197 carA carbamoyl-phosphate synthase arginine-specific small subunit; Provisional Back     alignment and domain information
>COG1797 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme metabolism] Back     alignment and domain information
>PRK12564 carbamoyl phosphate synthase small subunit; Reviewed Back     alignment and domain information
>cd01750 GATase1_CobQ Type 1 glutamine amidotransferase (GATase1) domain found in Cobyric Acid Synthase (CobQ) Back     alignment and domain information
>PRK14607 bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>COG0505 CarA Carbamoylphosphate synthase small subunit [Amino acid transport and metabolism / Nucleotide transport and metabolism] Back     alignment and domain information
>cd01747 GATase1_Glutamyl_Hydrolase Type 1 glutamine amidotransferase (GATase1) domain found in gamma-Glutamyl Hydrolase Back     alignment and domain information
>TIGR00379 cobB cobyrinic acid a,c-diamide synthase Back     alignment and domain information
>cd01745 GATase1_2 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information
>COG0047 PurL Phosphoribosylformylglycinamidine (FGAM) synthase, glutamine amidotransferase domain [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK00784 cobyric acid synthase; Provisional Back     alignment and domain information
>PRK01077 cobyrinic acid a,c-diamide synthase; Validated Back     alignment and domain information
>PLN02771 carbamoyl-phosphate synthase (glutamine-hydrolyzing) Back     alignment and domain information
>PRK13896 cobyrinic acid a,c-diamide synthase; Provisional Back     alignment and domain information
>PRK01175 phosphoribosylformylglycinamidine synthase I; Provisional Back     alignment and domain information
>PRK11366 puuD gamma-glutamyl-gamma-aminobutyrate hydrolase; Provisional Back     alignment and domain information
>PRK06186 hypothetical protein; Validated Back     alignment and domain information
>COG2071 Predicted glutamine amidotransferases [General function prediction only] Back     alignment and domain information
>KOG0026 consensus Anthranilate synthase, beta chain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06278 cobyrinic acid a,c-diamide synthase; Validated Back     alignment and domain information
>PRK05380 pyrG CTP synthetase; Validated Back     alignment and domain information
>PF07685 GATase_3: CobB/CobQ-like glutamine amidotransferase domain; InterPro: IPR011698 This group of enzymes was suggested to be related to the MinD family of ATPases involved in regulation of cell division in bacteria and archaea [] Back     alignment and domain information
>TIGR00313 cobQ cobyric acid synthase CobQ Back     alignment and domain information
>cd01740 GATase1_FGAR_AT Type 1 glutamine amidotransferase (GATase1)-like domain found in Formylglycinamide ribonucleotide amidotransferase Back     alignment and domain information
>TIGR00337 PyrG CTP synthase Back     alignment and domain information
>PF07722 Peptidase_C26: Peptidase C26; InterPro: IPR011697 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF13507 GATase_5: CobB/CobQ-like glutamine amidotransferase domain; PDB: 3D54_L 3UMM_A 3UJN_A 3UGJ_A 1T3T_A Back     alignment and domain information
>PLN02327 CTP synthase Back     alignment and domain information
>COG0504 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG1622 consensus GMP synthase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd01746 GATase1_CTP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in Cytidine Triphosphate Synthetase Back     alignment and domain information
>KOG0370 consensus Multifunctional pyrimidine synthesis protein CAD (includes carbamoyl-phophate synthetase, aspartate transcarbamylase, and glutamine amidotransferase) [General function prediction only] Back     alignment and domain information
>KOG3179 consensus Predicted glutamine synthetase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK05368 homoserine O-succinyltransferase; Provisional Back     alignment and domain information
>COG3442 Predicted glutamine amidotransferase [General function prediction only] Back     alignment and domain information
>KOG1224 consensus Para-aminobenzoate (PABA) synthase ABZ1 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1492 CobQ Cobyric acid synthase [Coenzyme metabolism] Back     alignment and domain information
>TIGR01857 FGAM-synthase phosphoribosylformylglycinamidine synthase, clade II Back     alignment and domain information
>PF09825 BPL_N: Biotin-protein ligase, N terminal; InterPro: IPR019197 The function of this structural domain is unknown Back     alignment and domain information
>KOG2387 consensus CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism] Back     alignment and domain information
>cd03146 GAT1_Peptidase_E Type 1 glutamine amidotransferase (GATase1)-like domain found in peptidase E Back     alignment and domain information
>PLN03206 phosphoribosylformylglycinamidine synthase; Provisional Back     alignment and domain information
>TIGR01735 FGAM_synt phosphoribosylformylglycinamidine synthase, single chain form Back     alignment and domain information
>PRK05297 phosphoribosylformylglycinamidine synthase; Provisional Back     alignment and domain information
>KOG1559 consensus Gamma-glutamyl hydrolase [Coenzyme transport and metabolism] Back     alignment and domain information
>PHA03366 FGAM-synthase; Provisional Back     alignment and domain information
>cd03144 GATase1_ScBLP_like Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Saccharomyces cerevisiae biotin-apoprotein ligase (ScBLP) Back     alignment and domain information
>PRK05282 (alpha)-aspartyl dipeptidase; Validated Back     alignment and domain information
>TIGR01382 PfpI intracellular protease, PfpI family Back     alignment and domain information
>TIGR01739 tegu_FGAM_synt herpesvirus tegument protein/v-FGAM-synthase Back     alignment and domain information
>PRK11780 isoprenoid biosynthesis protein with amidotransferase-like domain; Provisional Back     alignment and domain information
>cd03134 GATase1_PfpI_like A type 1 glutamine amidotransferase (GATase1)-like domain found in PfpI from Pyrococcus furiosus Back     alignment and domain information
>cd03169 GATase1_PfpI_1 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus Back     alignment and domain information
>cd03132 GATase1_catalase Type 1 glutamine amidotransferase (GATase1)-like domain found in at the C-terminal of several large catalases Back     alignment and domain information
>cd01653 GATase1 Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>COG4285 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd03135 GATase1_DJ-1 Type 1 glutamine amidotransferase (GATase1)-like domain found in Human DJ-1 Back     alignment and domain information
>COG0693 ThiJ Putative intracellular protease/amidase [General function prediction only] Back     alignment and domain information
>cd03128 GAT_1 Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>TIGR01383 not_thiJ DJ-1 family protein Back     alignment and domain information
>cd03129 GAT1_Peptidase_E_like Type 1 glutamine amidotransferase (GATase1)-like domain found in peptidase E_like proteins Back     alignment and domain information
>cd03137 GATase1_AraC_1 AraC transcriptional regulators having a Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>PRK11574 oxidative-stress-resistance chaperone; Provisional Back     alignment and domain information
>cd03138 GATase1_AraC_2 AraC transcriptional regulators having a Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>cd03133 GATase1_ES1 Type 1 glutamine amidotransferase (GATase1)-like domain found in zebrafish ES1 Back     alignment and domain information
>cd03140 GATase1_PfpI_3 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus Back     alignment and domain information
>cd03147 GATase1_Ydr533c_like Type 1 glutamine amidotransferase (GATase1)-like domain found in Saccharomyces cerevisiae Ydr533c protein Back     alignment and domain information
>cd03139 GATase1_PfpI_2 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus Back     alignment and domain information
>PRK11249 katE hydroperoxidase II; Provisional Back     alignment and domain information
>cd03136 GATase1_AraC_ArgR_like AraC transcriptional regulators having an N-terminal Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>PRK04155 chaperone protein HchA; Provisional Back     alignment and domain information
>cd03148 GATase1_EcHsp31_like Type 1 glutamine amidotransferase (GATase1)-like domain found in Escherichia coli Hsp31 protein (EcHsp31) Back     alignment and domain information
>PF01965 DJ-1_PfpI: DJ-1/PfpI family; InterPro: IPR002818 This signature defines a diverse group of protein families which include proteins involved in RNA-protein interaction regulation, thiamine biosynthesis, Ras-related signal transduction, and those with protease activity Back     alignment and domain information
>PF04204 HTS: Homoserine O-succinyltransferase ; InterPro: IPR005697 This family of enzymes, homoserine O-succinyltransferase, catalyses the first step in the biosynthesis of methionine: Succinyl-CoA + L-homoserine = CoA + O-succinyl-L-homoserine This enzyme is consequently essential for the survival of bacteria, plants and fungi Back     alignment and domain information
>cd03141 GATase1_Hsp31_like Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Escherichia coli Hsp31 protein Back     alignment and domain information
>PF03575 Peptidase_S51: Peptidase family S51; InterPro: IPR005320 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK09393 ftrA transcriptional activator FtrA; Provisional Back     alignment and domain information
>PF13278 DUF4066: Putative amidotransferase; PDB: 3BHN_A 3MGK_B 3NOV_A 3NON_B 3NOO_B 3NOQ_A 3NOR_A 3GRA_A 3EWN_A 3ER6_C Back     alignment and domain information
>cd03131 GATase1_HTS Type 1 glutamine amidotransferase (GATase1)-like domain found in homoserine trans-succinylase (HTS) Back     alignment and domain information
>KOG2764 consensus Putative transcriptional regulator DJ-1 [General function prediction only; Defense mechanisms] Back     alignment and domain information
>TIGR01001 metA homoserine O-succinyltransferase Back     alignment and domain information
>cd03145 GAT1_cyanophycinase Type 1 glutamine amidotransferase (GATase1)-like domain found in cyanophycinase Back     alignment and domain information
>TIGR02069 cyanophycinase cyanophycinase Back     alignment and domain information
>PF03698 UPF0180: Uncharacterised protein family (UPF0180); InterPro: IPR005370 The members of this family are small uncharacterised proteins Back     alignment and domain information
>COG3340 PepE Peptidase E [Amino acid transport and metabolism] Back     alignment and domain information
>PRK03094 hypothetical protein; Provisional Back     alignment and domain information
>KOG1907 consensus Phosphoribosylformylglycinamidine synthase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG4977 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain [Transcription] Back     alignment and domain information
>PRK01911 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>COG3155 ElbB Uncharacterized protein involved in an early stage of isoprenoid biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK03708 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK02649 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PF06283 ThuA: Trehalose utilisation; PDB: 4E5V_A 1T0B_A Back     alignment and domain information
>COG4635 HemG Flavodoxin [Energy production and conversion / Coenzyme metabolism] Back     alignment and domain information
>PRK14077 pnk inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK11104 hemG protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PRK04539 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>cd03143 A4_beta-galactosidase_middle_domain A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>PRK04885 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK03378 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK03372 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK02155 ppnK NAD(+)/NADH kinase family protein; Provisional Back     alignment and domain information
>PF08532 Glyco_hydro_42M: Beta-galactosidase trimerisation domain; InterPro: IPR013738 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PRK14075 pnk inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK14076 pnk inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK02645 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>COG4090 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>COG4242 CphB Cyanophycinase and related exopeptidases [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK01185 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK09271 flavodoxin; Provisional Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK01231 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PRK00561 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PF09198 T4-Gluco-transf: Bacteriophage T4 beta-glucosyltransferase; InterPro: IPR015281 Members of this family are DNA-modifying enzymes encoded by bacteriophage T4 that transfer glucose from uridine diphosphoglucose to 5-hydroxymethyl cytosine bases of phage T4 DNA [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query247
2nv0_A196 Structure Of The Glutaminase Subunit Pdx2 (Yaae) Of 4e-42
2iss_D208 Structure Of The Plp Synthase Holoenzyme From Therm 8e-42
1q7r_A219 X-Ray Crystallographic Analysis Of A Predicted Amid 2e-41
2nv2_B204 Structure Of The Plp Synthase Complex Pdx12 (YAADE) 3e-41
1r9g_A216 Three-Dimensional Structure Of Yaae From Bacillus S 3e-40
2ywd_A191 Crystal Structure Of Glutamine Amidotransferase Len 1e-39
2abw_A227 Glutaminase Subunit Of The Plasmodial Plp Synthase 4e-31
4ads_G217 Crystal Structure Of Plasmodial Plp Synthase Comple 3e-30
2ywj_A186 Crystal Structure Of Uncharacterized Conserved Prot 1e-27
>pdb|2NV0|A Chain A, Structure Of The Glutaminase Subunit Pdx2 (Yaae) Of Plp Synthase From Bacillus Subtilis Length = 196 Back     alignment and structure 
Iteration: 1

 Score =  167 bits (424), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 90/207 (43%), Positives = 124/207 (59%), Gaps = 21/207 (10%)
Query: 1   MVVGVLALQGSFNEHIAALKRLGVKGVEIRKPDQLQNVSSLIIPGGESTTMARLAEYHNL 60
           + +GVL LQG+  EHI A++  G  G+ +++P+QL  V  LI+PGGESTTM RL + +  
Sbjct: 2   LTIGVLGLQGAVREHIHAIEACGAAGLVVKRPEQLNEVDGLILPGGESTTMRRLIDTYQF 61
Query: 61  FPALREFVKMGKPVWGTCAGLIFLANKAVGQKLGGQELVGGLDCTVHRNFFGSQIQSFEA 120
              LREF   GKP++GTCAGLI LA +  G        +G L+  V RN FG Q+ SFEA
Sbjct: 62  MEPLREFAAQGKPMFGTCAGLIILAKEIAGSD---NPHLGLLNVVVERNSFGRQVDSFEA 118
Query: 121 ELSVPALASQEGGPETFRGVFIRAPAVLDVGPDVDVLADYPVPSNKENAMPEKKVIVAVR 180
           +L++  L       E F GVFIRAP +L+ G +V+VL+++               IVA +
Sbjct: 119 DLTIKGL------DEPFTGVFIRAPHILEAGENVEVLSEH------------NGRIVAAK 160
Query: 181 QGNLLGTAFHPELTADTRWHSYFLKMM 207
           QG  LG +FHPELT D R    F++M+
Sbjct: 161 QGQFLGCSFHPELTEDHRVTQLFVEMV 187
>pdb|2ISS|D Chain D, Structure Of The Plp Synthase Holoenzyme From Thermotoga Maritima Length = 208 Back     alignment and structure
>pdb|1Q7R|A Chain A, X-Ray Crystallographic Analysis Of A Predicted Amidotransferase From B. Stearothermophilus At 1.9 A Resolution Length = 219 Back     alignment and structure
>pdb|2NV2|B Chain B, Structure Of The Plp Synthase Complex Pdx12 (YAADE) FROM BACILLUS Subtilis Length = 204 Back     alignment and structure
>pdb|1R9G|A Chain A, Three-Dimensional Structure Of Yaae From Bacillus Subtilis Length = 216 Back     alignment and structure
>pdb|2YWD|A Chain A, Crystal Structure Of Glutamine Amidotransferase Length = 191 Back     alignment and structure
>pdb|2ABW|A Chain A, Glutaminase Subunit Of The Plasmodial Plp Synthase (Vitamin B6 Biosynthesis) Length = 227 Back     alignment and structure
>pdb|4ADS|G Chain G, Crystal Structure Of Plasmodial Plp Synthase Complex Length = 217 Back     alignment and structure
>pdb|2YWJ|A Chain A, Crystal Structure Of Uncharacterized Conserved Protein From Methanocaldococcus Jannaschii Length = 186 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query247
2nv0_A196 Glutamine amidotransferase subunit PDXT; 3-layer(A 6e-83
1q7r_A219 Predicted amidotransferase; structural genomics, Y 1e-81
2iss_D208 Glutamine amidotransferase subunit PDXT; (beta/alp 2e-81
2ywj_A186 Glutamine amidotransferase subunit PDXT; uncharact 7e-75
2abw_A227 PDX2 protein, glutaminase; PLP-synthase, vitamin B 5e-71
2ywd_A191 Glutamine amidotransferase subunit PDXT; pyridoxin 1e-70
1ka9_H200 Imidazole glycerol phosphtate synthase; riken stru 6e-09
1gpw_B201 Amidotransferase HISH; lyase/transferase, complex 1e-06
1jvn_A 555 Glutamine, bifunctional histidine biosynthesis pro 2e-05
3d54_D213 Phosphoribosylformylglycinamidine synthase 1; alph 8e-05
>2nv0_A Glutamine amidotransferase subunit PDXT; 3-layer(ABA) sandwich, rossmann fold, glutaminase; 1.73A {Bacillus subtilis} SCOP: c.23.16.1 PDB: 1r9g_A 2nv2_B* Length = 196 Back     alignment and structure
 Score =  245 bits (627), Expect = 6e-83
 Identities = 91/212 (42%), Positives = 126/212 (59%), Gaps = 21/212 (9%)

Query: 1   MVVGVLALQGSFNEHIAALKRLGVKGVEIRKPDQLQNVSSLIIPGGESTTMARLAEYHNL 60
           + +GVL LQG+  EHI A++  G  G+ +++P+QL  V  LI+PGGESTTM RL + +  
Sbjct: 2   LTIGVLGLQGAVREHIHAIEACGAAGLVVKRPEQLNEVDGLILPGGESTTMRRLIDTYQF 61

Query: 61  FPALREFVKMGKPVWGTCAGLIFLANKAVGQKLGGQELVGGLDCTVHRNFFGSQIQSFEA 120
              LREF   GKP++GTCAGLI LA +  G        +G L+  V RN FG Q+ SFEA
Sbjct: 62  MEPLREFAAQGKPMFGTCAGLIILAKEIAG---SDNPHLGLLNVVVERNSFGRQVDSFEA 118

Query: 121 ELSVPALASQEGGPETFRGVFIRAPAVLDVGPDVDVLADYPVPSNKENAMPEKKVIVAVR 180
           +L++       G  E F GVFIRAP +L+ G +V+VL+++               IVA +
Sbjct: 119 DLTIK------GLDEPFTGVFIRAPHILEAGENVEVLSEH------------NGRIVAAK 160

Query: 181 QGNLLGTAFHPELTADTRWHSYFLKMMSEVGE 212
           QG  LG +FHPELT D R    F++M+ E  +
Sbjct: 161 QGQFLGCSFHPELTEDHRVTQLFVEMVEEYKQ 192
>1q7r_A Predicted amidotransferase; structural genomics, YAAE, PDX2, predicted glutamine amidotransferase, PSI; HET: MSE; 1.90A {Geobacillus stearothermophilus} SCOP: c.23.16.1 Length = 219 Back     alignment and structure
>2iss_D Glutamine amidotransferase subunit PDXT; (beta/alpha)8-barrel, alpha/beta three layer sandwich, lyase transferase; HET: 5RP; 2.90A {Thermotoga maritima} Length = 208 Back     alignment and structure
>2ywj_A Glutamine amidotransferase subunit PDXT; uncharacterized conserved protein, structural genomics; 1.90A {Methanocaldococcus jannaschii} Length = 186 Back     alignment and structure
>2abw_A PDX2 protein, glutaminase; PLP-synthase, vitamin B6, malaria, transferase; HET: PG4; 1.62A {Plasmodium falciparum} SCOP: c.23.16.1 PDB: 4ads_G Length = 227 Back     alignment and structure
>2ywd_A Glutamine amidotransferase subunit PDXT; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Length = 191 Back     alignment and structure
>1ka9_H Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.23.16.1 Length = 200 Back     alignment and structure
>1gpw_B Amidotransferase HISH; lyase/transferase, complex (lyase/transferase), histidine biosynthesis, glutaminase, glutamine amidotransferase; 2.4A {Thermotoga maritima} SCOP: c.23.16.1 PDB: 1k9v_F 1kxj_A 2wjz_B Length = 201 Back     alignment and structure
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A Length = 555 Back     alignment and structure
>3d54_D Phosphoribosylformylglycinamidine synthase 1; alpha-beta structure, ATP-binding, cytoplasm, ligase, nucleotide-binding, purine biosynthesis; HET: CYG ADP; 3.50A {Thermotoga maritima} Length = 213 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query247
4gud_A211 Imidazole glycerol phosphate synthase subunit His; 100.0
2iss_D208 Glutamine amidotransferase subunit PDXT; (beta/alp 99.97
2nv0_A196 Glutamine amidotransferase subunit PDXT; 3-layer(A 99.97
2ywj_A186 Glutamine amidotransferase subunit PDXT; uncharact 99.97
2abw_A227 PDX2 protein, glutaminase; PLP-synthase, vitamin B 99.97
2ywd_A191 Glutamine amidotransferase subunit PDXT; pyridoxin 99.97
1q7r_A219 Predicted amidotransferase; structural genomics, Y 99.97
1ka9_H200 Imidazole glycerol phosphtate synthase; riken stru 99.96
1gpw_B201 Amidotransferase HISH; lyase/transferase, complex 99.96
1jvn_A 555 Glutamine, bifunctional histidine biosynthesis pro 99.95
3d54_D213 Phosphoribosylformylglycinamidine synthase 1; alph 99.94
2a9v_A212 GMP synthase; structural genomics, joint center fo 99.92
1wl8_A189 GMP synthase [glutamine-hydrolyzing] subunit A; tr 99.92
1qdl_B195 Protein (anthranilate synthase (TRPG-SUBUNIT)); tr 99.92
3l7n_A236 Putative uncharacterized protein; glutamine amidot 99.9
1i1q_B192 Anthranilate synthase component II; tryptophan bio 99.9
2vpi_A218 GMP synthase; guanine monophosphate synthetase, ph 99.89
3m3p_A250 Glutamine amido transferase; structural genomics, 99.89
1o1y_A239 Conserved hypothetical protein TM1158; flavodoxin- 99.89
3fij_A254 LIN1909 protein; 11172J, uncharacterized protein, 99.89
3tqi_A 527 GMP synthase [glutamine-hydrolyzing]; ligase; 2.84 99.88
1a9x_B379 Carbamoyl phosphate synthetase (small chain); amid 99.87
3uow_A 556 GMP synthetase; structural genomics consortium, SG 99.87
3r75_A645 Anthranilate/para-aminobenzoate synthases compone; 99.86
2ywb_A 503 GMP synthase [glutamine-hydrolyzing]; GMP syntheta 99.86
1gpm_A 525 GMP synthetase, XMP aminase; class I glutamine ami 99.86
2w7t_A273 CTP synthetase, putative cytidine triphosphate syn 99.85
1l9x_A315 Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCO 99.81
2vxo_A 697 GMP synthase [glutamine-hydrolyzing]; proto-oncoge 99.77
2v4u_A289 CTP synthase 2; pyrimidine biosynthesis, glutamine 99.76
1vco_A550 CTP synthetase; tetramer, riken structural genomic 99.71
3nva_A535 CTP synthase; rossman fold, nucleotide binding, LI 99.6
2vdj_A301 Homoserine O-succinyltransferase; methionine biosy 99.57
2h2w_A312 Homoserine O-succinyltransferase; TM0881, (EC 2.3. 99.57
1s1m_A545 CTP synthase; CTP synthetase, UTP:ammonia ligase ( 99.56
1fy2_A229 Aspartyl dipeptidase; serine protease, catalytic t 99.48
3ugj_A1303 Phosphoribosylformylglycinamidine synthase; amidot 99.41
3l4e_A206 Uncharacterized peptidase LMO0363; hypothetical pr 99.33
1oi4_A193 Hypothetical protein YHBO; PFPI/THIJ family, compl 99.05
3l18_A168 Intracellular protease I; gatase1_PFPI_LIKE, hydro 98.98
2rk3_A197 Protein DJ-1; parkinson'S disease, THIJ, PFPI, cha 98.8
2ab0_A205 YAJL; DJ-1/THIJ superfamily, alpha-beta hydrolase 98.77
4e08_A190 DJ-1 beta; flavodoxin-like fold, stress response, 98.77
2vrn_A190 Protease I, DR1199; cysteine sulfenic acid, DJ-1/T 98.76
2fex_A188 Conserved hypothetical protein; structural genomic 98.73
4hcj_A177 THIJ/PFPI domain protein; structural genomics, PSI 98.72
3er6_A209 Putative transcriptional regulator protein; struct 98.66
3efe_A212 THIJ/PFPI family protein; structural GEN csgid, ce 98.58
3ot1_A208 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate 98.57
3mgk_A211 Intracellular protease/amidase related enzyme (THI 98.57
3noq_A231 THIJ/PFPI family protein; DJ-1 superfamily, isocya 98.54
3f5d_A206 Protein YDEA; unknow protein, PSI-II, nysgrc, stru 98.51
3cne_A175 Putative protease I; structural genomics, PSI-2, M 98.49
3uk7_A396 Class I glutamine amidotransferase-like domain-CO 98.47
3uk7_A396 Class I glutamine amidotransferase-like domain-CO 98.46
3l3b_A242 ES1 family protein; ssgcid, NIH, niaid, SBRI, UW, 98.45
3ewn_A253 THIJ/PFPI family protein; monomer, PSI nysgrc, str 98.4
3gra_A202 Transcriptional regulator, ARAC family; transcript 98.38
4gdh_A194 DJ-1, uncharacterized protein C22E12.03C; unknown 98.34
1u9c_A224 APC35852; structural genomics, protein structure i 98.33
3fse_A365 Two-domain protein containing DJ-1/THIJ/PFPI-like 98.32
1vhq_A232 Enhancing lycopene biosynthesis protein 2; structu 98.3
3ej6_A688 Catalase-3; heme, hydrogen iron, metal-binding, ox 98.29
3ttv_A753 Catalase HPII; heme orientation, oxidoreductase; H 98.25
1sy7_A715 Catalase 1; heme oxidation, singlet oxygen, oxidor 98.16
3n7t_A247 Macrophage binding protein; seattle structural gen 98.15
1rw7_A243 YDR533CP; alpha-beta sandwich, DJ-1/THIJ/PFPI supe 98.05
2iuf_A688 Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Pen 98.02
3kkl_A244 Probable chaperone protein HSP33; peptidase, heat 98.02
3bhn_A236 THIJ/PFPI domain protein; structural genomics, joi 97.94
1n57_A291 Chaperone HSP31, protein YEDU; alpha-beta sandwich 97.72
3en0_A291 Cyanophycinase; serine protease, beta peptide spec 97.69
2gk3_A256 Putative cytoplasmic protein; STM3548, structural 95.91
1z0s_A278 Probable inorganic polyphosphate/ATP-NAD kinase; A 94.4
4e5v_A281 Putative THUA-like protein; THUA-like proteins, tr 91.89
2i2c_A272 Probable inorganic polyphosphate/ATP-NAD kinase 1; 90.82
3rht_A259 (gatase1)-like protein; structural genomics, PSI-b 87.35
1u0t_A307 Inorganic polyphosphate/ATP-NAD kinase; alpha-beta 86.62
2an1_A292 Putative kinase; structural genomics, PSI, protein 85.14
2zuv_A759 Lacto-N-biose phosphorylase; beta-alpha-barrel, TI 83.71
3tty_A675 Beta-GAL, beta-galactosidase; TIM barrel, glycosid 83.1
1t0b_A252 THUA-like protein; trehalose metabolism, NCS symme 82.1
>4gud_A Imidazole glycerol phosphate synthase subunit His; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE 1PE; 1.91A {Vibrio cholerae} Back     alignment and structure
Probab=100.00  E-value=3.3e-35  Score=248.13  Aligned_cols=190  Identities=22%  Similarity=0.348  Sum_probs=143.9

Q ss_pred             EEEEEec-CCChHHHHHHHHhCCCeEEEECCccCCCCCCEEEECC-Cc-hhHHHHHHhhCCHHHHHHHHHHcCCcEEEEe
Q 025812            2 VVGVLAL-QGSFNEHIAALKRLGVKGVEIRKPDQLQNVSSLIIPG-GE-STTMARLAEYHNLFPALREFVKMGKPVWGTC   78 (247)
Q Consensus         2 ~I~vl~~-~G~~~~~~~~L~~~G~~v~~~~~~~~l~~~d~lilpG-G~-~~~~~~l~~~~~~~~~i~~~~~~g~PilGIC   78 (247)
                      ||+|+++ .||+.|+.++|+++|++++++++++++.++|+||||| |. .+.+..+.. .+   .++.+.+.++|+||||
T Consensus         4 ~I~iiD~g~~n~~si~~al~~~G~~~~v~~~~~~l~~~D~lilPG~g~~~~~~~~~~~-~~---~i~~~~~~~~PvlGIC   79 (211)
T 4gud_A            4 NVVIIDTGCANISSVKFAIERLGYAVTISRDPQVVLAADKLFLPGVGTASEAMKNLTE-RD---LIELVKRVEKPLLGIC   79 (211)
T ss_dssp             CEEEECCCCTTHHHHHHHHHHTTCCEEEECCHHHHHHCSEEEECCCSCHHHHHHHHHH-TT---CHHHHHHCCSCEEEET
T ss_pred             EEEEEECCCChHHHHHHHHHHCCCEEEEECCHHHHhCCCEEEECCCCCHHHHHHHHHh-cC---hHHHHHHcCCCEEEEc
Confidence            6999998 4688999999999999999999999999999999999 44 334455543 23   3455667899999999


Q ss_pred             hhHHHHHHhhhccc---CCCcccccceeeEEEeeccCCccccccccccCCcccccCCCCcceeeeeecCceeeecCC--C
Q 025812           79 AGLIFLANKAVGQK---LGGQELVGGLDCTVHRNFFGSQIQSFEAELSVPALASQEGGPETFRGVFIRAPAVLDVGP--D  153 (247)
Q Consensus        79 ~G~QlL~~~~~~~~---~g~~~~LG~l~g~v~~~~~g~~~~~~~~~~~v~~~Gw~~~~~~~~~~~~~~~~l~~~l~~--~  153 (247)
                      +|||+|+.++++..   .....+++++++++.+...+        ....++.+|+.+...      ..+++++++++  .
T Consensus        80 lG~QlL~~~~g~~~~~~~~~~~gl~~~~~~v~~~~~~--------~~~~~~~~~~~~~~~------~~~~l~~~l~~~~~  145 (211)
T 4gud_A           80 LGMQLLGKLSEEKGQKADEIVQCLGLVDGEVRLLQTG--------DLPLPHMGWNTVQVK------EGHPLFNGIEPDAY  145 (211)
T ss_dssp             HHHHTTSSEECCC----CCCEECCCSSSCEEEECCCT--------TSCSSEEEEECCEEC------TTCGGGTTCCTTCC
T ss_pred             hhHhHHHHHhCCcccccCCccccceeccceEEEcccC--------Ccceeeccceeeeee------ccChhhcCCCCCcE
Confidence            99999999886532   12356899999999887422        245678888764321      35778887754  4


Q ss_pred             eEEEEEEeCCCCCC---CCCCCCcEEEEEeeCCEEEEeeCCCCCCch--HHHHHHHHHHHh
Q 025812          154 VDVLADYPVPSNKE---NAMPEKKVIVAVRQGNLLGTAFHPELTADT--RWHSYFLKMMSE  209 (247)
Q Consensus       154 ~~~~hs~~~~~~~~---~~~~~~~~~~~~~~~~i~gvQFHPE~s~~~--~i~~nfl~~~~~  209 (247)
                      ++++|++.+++...   +++++..+.++++++|++|+|||||++.+.  +|++||+++|.+
T Consensus       146 ~~~~H~~~v~~~~~~~a~~~~g~~~~~~v~~~~v~GvQFHPE~s~~~G~~ll~nFl~~~ge  206 (211)
T 4gud_A          146 FYFVHSFAMPVGDYTIAQCEYGQPFSAAIQAGNYYGVQFHPERSSKAGARLIQNFLELRGE  206 (211)
T ss_dssp             EEEEESEECCCCTTEEEEEESSSEEEEEEEETTEEEESSCGGGSHHHHHHHHHHHHHC---
T ss_pred             EEEEeeEEeCCCCeEEEEecCCCeEEEEEeCCCEEEEEccCEecCccHHHHHHHHHHHhcc
Confidence            67789988865442   456666788889999999999999998654  699999998863
>2iss_D Glutamine amidotransferase subunit PDXT; (beta/alpha)8-barrel, alpha/beta three layer sandwich, lyase transferase; HET: 5RP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2nv0_A Glutamine amidotransferase subunit PDXT; 3-layer(ABA) sandwich, rossmann fold, glutaminase; 1.73A {Bacillus subtilis} SCOP: c.23.16.1 PDB: 1r9g_A 2nv2_B* Back     alignment and structure
>2ywj_A Glutamine amidotransferase subunit PDXT; uncharacterized conserved protein, structural genomics; 1.90A {Methanocaldococcus jannaschii} Back     alignment and structure
>2abw_A PDX2 protein, glutaminase; PLP-synthase, vitamin B6, malaria, transferase; HET: PG4; 1.62A {Plasmodium falciparum} SCOP: c.23.16.1 PDB: 4ads_G Back     alignment and structure
>2ywd_A Glutamine amidotransferase subunit PDXT; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>1q7r_A Predicted amidotransferase; structural genomics, YAAE, PDX2, predicted glutamine amidotransferase, PSI; HET: MSE; 1.90A {Geobacillus stearothermophilus} SCOP: c.23.16.1 Back     alignment and structure
>1ka9_H Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.23.16.1 Back     alignment and structure
>1gpw_B Amidotransferase HISH; lyase/transferase, complex (lyase/transferase), histidine biosynthesis, glutaminase, glutamine amidotransferase; 2.4A {Thermotoga maritima} SCOP: c.23.16.1 PDB: 1k9v_F 1kxj_A 2wjz_B Back     alignment and structure
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A Back     alignment and structure
>3d54_D Phosphoribosylformylglycinamidine synthase 1; alpha-beta structure, ATP-binding, cytoplasm, ligase, nucleotide-binding, purine biosynthesis; HET: CYG ADP; 3.50A {Thermotoga maritima} Back     alignment and structure
>2a9v_A GMP synthase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, ligase; 2.24A {Thermoplasma acidophilum} SCOP: c.23.16.1 Back     alignment and structure
>1wl8_A GMP synthase [glutamine-hydrolyzing] subunit A; transferase, gatases, riken structural genomics/proteomics initiative, RSGI; 1.45A {Pyrococcus horikoshii} SCOP: c.23.16.1 PDB: 2d7j_A Back     alignment and structure
>1qdl_B Protein (anthranilate synthase (TRPG-SUBUNIT)); tryptophan biosynthesis, glutamine amidotransferase, allosteric interaction, lyase; 2.50A {Sulfolobus solfataricus} SCOP: c.23.16.1 Back     alignment and structure
>3l7n_A Putative uncharacterized protein; glutamine amidotransferase, transferas; 2.70A {Streptococcus mutans} Back     alignment and structure
>1i1q_B Anthranilate synthase component II; tryptophan biosynthesis, lyase; HET: TRP; 1.90A {Salmonella typhimurium} SCOP: c.23.16.1 PDB: 1i7q_B 1i7s_B* Back     alignment and structure
>2vpi_A GMP synthase; guanine monophosphate synthetase, phosphoprotein, GMP synthetase, GMP biosynthesis, glutamine amidotransferase, ligase, cytoplasm; 2.40A {Homo sapiens} Back     alignment and structure
>3m3p_A Glutamine amido transferase; structural genomics, nysgrc, PSI-2; HET: MSE; 1.30A {Methylobacillus flagellatus} PDB: 3l83_A* Back     alignment and structure
>1o1y_A Conserved hypothetical protein TM1158; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG; 1.70A {Thermotoga maritima} SCOP: c.23.16.1 Back     alignment and structure
>3fij_A LIN1909 protein; 11172J, uncharacterized protein, nysgrc, PSI-II, structural genomics, protein structure initiative; 2.30A {Listeria innocua} Back     alignment and structure
>3tqi_A GMP synthase [glutamine-hydrolyzing]; ligase; 2.84A {Coxiella burnetii} Back     alignment and structure
>1a9x_B Carbamoyl phosphate synthetase (small chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: c.8.3.1 c.23.16.1 PDB: 1bxr_B* 1ce8_B* 1jdb_C* 1cs0_B* 1m6v_B* 1c30_B* 1c3o_B* 1kee_B* 1t36_B* Back     alignment and structure
>3uow_A GMP synthetase; structural genomics consortium, SGC, purine nucleotide biosy process, ligase; HET: XMP; 2.72A {Plasmodium falciparum} Back     alignment and structure
>3r75_A Anthranilate/para-aminobenzoate synthases compone; ammonia channel, chorismate, type 1 glutamine amidotransfera phenazine biosynthesis, lyase; HET: CYG; 2.10A {Burkholderia SP} PDB: 3r74_A* 3r76_A* Back     alignment and structure
>2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway, structural genomics; 2.10A {Thermus thermophilus} PDB: 2ywc_A* Back     alignment and structure
>1gpm_A GMP synthetase, XMP aminase; class I glutamine amidotransferase, N-type ATP pyrophosphata transferase (glutamine amidotransferase); HET: AMP CIT; 2.20A {Escherichia coli} SCOP: c.23.16.1 c.26.2.1 d.52.2.1 Back     alignment and structure
>2w7t_A CTP synthetase, putative cytidine triphosphate synthase; glutaminase domain, trypsanosoma brucei, ligase, acivicin; HET: 5CS; 2.10A {Trypanosoma brucei} Back     alignment and structure
>1l9x_A Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCOP: c.23.16.1 Back     alignment and structure
>2vxo_A GMP synthase [glutamine-hydrolyzing]; proto-oncogene, phosphoprotein, GMP synthetase, guanine monophosphate synthetase, chromosomal rearrangement; HET: XMP; 2.5A {Homo sapiens} Back     alignment and structure
>2v4u_A CTP synthase 2; pyrimidine biosynthesis, glutamine amidotransferase, glutaminase domain, 5-OXO-L-norleucine, DON, ligase, phosphoprotein; HET: CYD; 2.3A {Homo sapiens} PDB: 2vkt_A Back     alignment and structure
>1vco_A CTP synthetase; tetramer, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; HET: GLN; 2.15A {Thermus thermophilus} SCOP: c.23.16.1 c.37.1.10 PDB: 1vcn_A 1vcm_A Back     alignment and structure
>3nva_A CTP synthase; rossman fold, nucleotide binding, LIG; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>2vdj_A Homoserine O-succinyltransferase; methionine biosynthesis, amino-acid biosynthesis, homoserine transacetylase, homoserine transsuccinylase; 2.00A {Bacillus cereus} PDB: 2ghr_A Back     alignment and structure
>2h2w_A Homoserine O-succinyltransferase; TM0881, (EC 2.3.1.46), HOM O-transsuccinylase, HTS, (TM0881), structural genomics; 2.52A {Thermotoga maritima} Back     alignment and structure
>1s1m_A CTP synthase; CTP synthetase, UTP:ammonia ligase (ADP-forming), cytidine 5 triphosphate synthase, ammonia lyase; 2.30A {Escherichia coli} SCOP: c.23.16.1 c.37.1.10 PDB: 2ad5_A* Back     alignment and structure
>1fy2_A Aspartyl dipeptidase; serine protease, catalytic triad, strand-helix MO hydrolase; 1.20A {Salmonella typhimurium} SCOP: c.23.16.4 PDB: 1fye_A Back     alignment and structure
>3ugj_A Phosphoribosylformylglycinamidine synthase; amidotransferase, glutaminase, thioester intermediate, ligas; HET: ADP; 1.78A {Salmonella enterica subsp} PDB: 1t3t_A* 3ujn_A* 3umm_A* Back     alignment and structure
>3l4e_A Uncharacterized peptidase LMO0363; hypothetical protein LMO0363, csgid, similar to peptidase E, hydrolase, protease, serine protease; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1oi4_A Hypothetical protein YHBO; PFPI/THIJ family, complete proteome, PFPI, THIJ, bacterial targets at IGS-CNRS, france, BIGS, structural genomics; 2.03A {Escherichia coli} SCOP: c.23.16.2 Back     alignment and structure
>3l18_A Intracellular protease I; gatase1_PFPI_LIKE, hydrolase; 1.78A {Thermococcus onnurineus} SCOP: c.23.16.2 PDB: 1g2i_A Back     alignment and structure
>2rk3_A Protein DJ-1; parkinson'S disease, THIJ, PFPI, chaperone, cytoplasm, disease mutation, nucleus, oncogene, oxidation, parkinson disease; 1.05A {Homo sapiens} PDB: 1pdv_A 1pdw_A 3cy6_A 1pe0_A 3cza_A 3cyf_A 2rk4_A 3cz9_A* 3ezg_A 3f71_A 3sf8_A 1p5f_A 1ps4_A 1q2u_A 1soa_A 1ucf_A 2or3_A 3bwe_A 3b38_A 3b36_A ... Back     alignment and structure
>2ab0_A YAJL; DJ-1/THIJ superfamily, alpha-beta hydrolase fold, unknown function; 1.10A {Escherichia coli} SCOP: c.23.16.2 Back     alignment and structure
>4e08_A DJ-1 beta; flavodoxin-like fold, stress response, motor protein; 2.00A {Drosophila melanogaster} Back     alignment and structure
>2vrn_A Protease I, DR1199; cysteine sulfenic acid, DJ-1/THIJ/PFPI superfamily, protease hydrolase, stress response; 2.15A {Deinococcus radiodurans} Back     alignment and structure
>2fex_A Conserved hypothetical protein; structural genomics, protein structure initiative, PSI, MIDW center for structural genomics, MCSG; 1.70A {Agrobacterium tumefaciens} SCOP: c.23.16.2 Back     alignment and structure
>4hcj_A THIJ/PFPI domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta-alpha sandwich; HET: MSE; 1.12A {Brachyspira murdochii} Back     alignment and structure
>3er6_A Putative transcriptional regulator protein; structural genomics, unknown function, DNA-binding, transcription regulation, PSI-2; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>3efe_A THIJ/PFPI family protein; structural GEN csgid, center for structural genomics of infectious disease chaperone; 2.30A {Bacillus anthracis} Back     alignment and structure
>3ot1_A 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme; csgid, structural genomics; HET: MSE CSX; 1.16A {Vibrio cholerae o1 biovar el tor} SCOP: c.23.16.0 Back     alignment and structure
>3mgk_A Intracellular protease/amidase related enzyme (THIJ family); amidotranferase-like, structural genomics, PSI; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3noq_A THIJ/PFPI family protein; DJ-1 superfamily, isocyanide hydratase, isonitrIle hydratase; HET: NHE; 1.00A {Pseudomonas fluorescens} PDB: 3noo_A 3non_A 3nor_A* 3nov_A Back     alignment and structure
>3f5d_A Protein YDEA; unknow protein, PSI-II, nysgrc, structural genomics, protein structure initiative; 2.06A {Bacillus subtilis} Back     alignment and structure
>3cne_A Putative protease I; structural genomics, PSI-2, MCSG, protein struct initiative, midwest center for structural genomics; HET: FMN; 1.99A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3uk7_A Class I glutamine amidotransferase-like domain-CO protein; rossmann fold, cytosol; 2.05A {Arabidopsis thaliana} Back     alignment and structure
>3uk7_A Class I glutamine amidotransferase-like domain-CO protein; rossmann fold, cytosol; 2.05A {Arabidopsis thaliana} Back     alignment and structure
>3l3b_A ES1 family protein; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography, isopr biosynthesis; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>3ewn_A THIJ/PFPI family protein; monomer, PSI nysgrc, structural genomics, protein structure initiative; 1.65A {Pseudomonas syringae PV} Back     alignment and structure
>3gra_A Transcriptional regulator, ARAC family; transcription regulator, PSI-II, structural genomics structure initiative; 2.30A {Pseudomonas putida} Back     alignment and structure
>4gdh_A DJ-1, uncharacterized protein C22E12.03C; unknown function, cysteine oxidation; 1.05A {Schizosaccharomyces pombe} PDB: 4ge3_A 4ge0_A Back     alignment and structure
>1u9c_A APC35852; structural genomics, protein structure initiative, MCSG, PAR disease, chaperone, cysteine protease, PSI; 1.35A {Geobacillus stearothermophilus} SCOP: c.23.16.2 Back     alignment and structure
>3fse_A Two-domain protein containing DJ-1/THIJ/PFPI-like ferritin-like domains; structural genomics; HET: MSE CSX; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1vhq_A Enhancing lycopene biosynthesis protein 2; structural genomics, unknown function; 1.65A {Escherichia coli} SCOP: c.23.16.2 PDB: 1oy1_A Back     alignment and structure
>3ej6_A Catalase-3; heme, hydrogen iron, metal-binding, oxidoreductase, peroxidase; HET: NAG HEM; 2.30A {Neurospora crassa} Back     alignment and structure
>3ttv_A Catalase HPII; heme orientation, oxidoreductase; HET: HEM; 1.45A {Escherichia coli} PDB: 3ttt_A* 1gge_A* 1iph_A* 4ens_A* 3ttu_A* 3p9p_A* 4enq_A* 1p81_A* 3ttx_A* 4enw_A* 3ttw_A* 4ent_A* 1qws_A* 1cf9_A* 1p80_A* 1qf7_A* 4enu_A* 4enp_A* 1gg9_A* 1ggf_A* ... Back     alignment and structure
>1sy7_A Catalase 1; heme oxidation, singlet oxygen, oxidoreductase; HET: HDD HEM; 1.75A {Neurospora crassa} SCOP: c.23.16.3 Back     alignment and structure
>3n7t_A Macrophage binding protein; seattle structural genomics center for infectious disease, S macrophage, pathogenic fungus, coccidioidomycosis; 2.10A {Coccidioides immitis} SCOP: c.23.16.0 Back     alignment and structure
>1rw7_A YDR533CP; alpha-beta sandwich, DJ-1/THIJ/PFPI superfamily, unknown function; 1.80A {Saccharomyces cerevisiae} SCOP: c.23.16.2 PDB: 1qvv_A* 1qvz_A 1qvw_A Back     alignment and structure
>2iuf_A Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Penicillium janthinellum} PDB: 2xf2_A* Back     alignment and structure
>3kkl_A Probable chaperone protein HSP33; peptidase, heat shock protein, hydrolase, protease, stress response; 2.03A {Saccharomyces cerevisiae} PDB: 3mii_A* Back     alignment and structure
>3bhn_A THIJ/PFPI domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.76A {Shewanella loihica pv-4} Back     alignment and structure
>1n57_A Chaperone HSP31, protein YEDU; alpha-beta sandwich; 1.60A {Escherichia coli} SCOP: c.23.16.2 PDB: 1pv2_A 1izy_A 1ons_A 1izz_A Back     alignment and structure
>3en0_A Cyanophycinase; serine protease, beta peptide specific, hydrolase, protease; 1.50A {Synechocystis SP} Back     alignment and structure
>2gk3_A Putative cytoplasmic protein; STM3548, structural genomics, PSI, P structure initiative; 2.25A {Salmonella typhimurium} SCOP: c.23.16.9 Back     alignment and structure
>1z0s_A Probable inorganic polyphosphate/ATP-NAD kinase; ATP-binding, structural genomics, NADP, PSI, protein structure initiative; HET: ATP; 1.70A {Archaeoglobus fulgidus} SCOP: e.52.1.1 PDB: 1z0u_A* 1z0z_A* 1suw_A* Back     alignment and structure
>4e5v_A Putative THUA-like protein; THUA-like proteins, trehalose utilisation, structural genomi center for structural genomics, JCSG; 1.75A {Parabacteroides merdae} Back     alignment and structure
>2i2c_A Probable inorganic polyphosphate/ATP-NAD kinase 1; NADP bound of lmnadk1, transferase; HET: DTA PG4; 1.85A {Listeria monocytogenes egd-e} PDB: 2i1w_A* 2i2a_A* 2i2b_A* 2i29_A* 2i2d_A* 2i2e_A* 3v7u_A* 3v7w_A* 3v7y_A* 3v80_A* 3v8m_A* 3v8n_A* 3v8p_A* 4dy6_A* 2i2f_A* 2q5f_A* 3v8q_A* 3v8r_A* Back     alignment and structure
>3rht_A (gatase1)-like protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.83A {Planctomyces limnophilus} Back     alignment and structure
>1u0t_A Inorganic polyphosphate/ATP-NAD kinase; alpha-beta, beta sandwich, structural genomics, PSI, protein structure initiative; 2.30A {Mycobacterium tuberculosis} SCOP: e.52.1.1 PDB: 1u0r_A 1y3i_A* 1y3h_A Back     alignment and structure
>2an1_A Putative kinase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, transferase; 2.00A {Salmonella typhimurium} Back     alignment and structure
>2zuv_A Lacto-N-biose phosphorylase; beta-alpha-barrel, TIM barrel, glycosyltransferase, transferase; HET: NDG; 1.85A {Bifidobacterium longum} PDB: 2zus_A* 2zuu_A* 2zut_A* 2zuw_A* Back     alignment and structure
>3tty_A Beta-GAL, beta-galactosidase; TIM barrel, glycoside hydrolase, hydrolase; HET: GLA; 2.25A {Bacillus circulans subsp} PDB: 3tts_A* Back     alignment and structure
>1t0b_A THUA-like protein; trehalose metabolism, NCS symmetry, structural genomics, PSI, protein structure initiative; 1.70A {Geobacillus stearothermophilus} SCOP: c.23.16.6 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 247
d2abwa1218 c.23.16.1 (A:2-219) Pyridoxine biosynthesis protei 1e-40
d2nv0a1195 c.23.16.1 (A:1-195) Hypothetical protein YaaE {Bac 2e-40
d1q7ra_202 c.23.16.1 (A:) Hypothetical protein YaaE {Bacillus 2e-40
d1jvna2232 c.23.16.1 (A:-3-229) GAT subunit, HisH, (or domain 3e-11
d1k9vf_200 c.23.16.1 (F:) GAT subunit, HisH, (or domain) of i 1e-06
d1ka9h_195 c.23.16.1 (H:) GAT subunit, HisH, (or domain) of i 4e-05
>d2abwa1 c.23.16.1 (A:2-219) Pyridoxine biosynthesis protein 2, Pdx2 {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 218 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Class I glutamine amidotransferase-like
family: Class I glutamine amidotransferases (GAT)
domain: Pyridoxine biosynthesis protein 2, Pdx2
species: Malaria parasite (Plasmodium falciparum) [TaxId: 5833]

 Score =  137 bits (345), Expect = 1e-40
 Identities = 80/220 (36%), Positives = 107/220 (48%), Gaps = 19/220 (8%)

Query: 1   MVVGVLALQGSFNEHIAALKRLGVKGVEI---RKPDQLQNVSSLIIPGGESTTMAR--LA 55
           + +GVL+LQG F  HI    +L +  + I   R    L     L+IPGGESTT+ R    
Sbjct: 3   ITIGVLSLQGDFEPHINHFIKLQIPSLNIIQVRNVHDLGLCDGLVIPGGESTTVRRCCAY 62

Query: 56  EYHNLFPALREFVK-MGKPVWGTCAGLIFLANKAVGQKLGG----QELVGGLDCTVHRNF 110
           E   L+ AL  F+  + KP+WGTCAG I L+      KL      +   GGLD T+ RNF
Sbjct: 63  ENDTLYNALVHFIHVLKKPIWGTCAGCILLSKNVENIKLYSNFGNKFSFGGLDITICRNF 122

Query: 111 FGSQIQSFEAELSVPALASQEGGPETFRGVFIRAP-AVLDVGPDVDVLADYPVPSNKENA 169
           +GSQ  SF   L++ +        +      IRAP     +  +V VLA +   S   N 
Sbjct: 123 YGSQNDSFICSLNIIS--DSSAFKKDLTAACIRAPYIREILSDEVKVLATFSHESYGPN- 179

Query: 170 MPEKKVIVAVRQGNLLGTAFHPELTADTRWHSYFLKMMSE 209
                +I AV Q N LGT FHPEL   T +  YF + +  
Sbjct: 180 -----IIAAVEQNNCLGTVFHPELLPHTAFQQYFYEKVKN 214
>d2nv0a1 c.23.16.1 (A:1-195) Hypothetical protein YaaE {Bacillus subtilis [TaxId: 1423]} Length = 195 Back     information, alignment and structure
>d1q7ra_ c.23.16.1 (A:) Hypothetical protein YaaE {Bacillus stearothermophilus [TaxId: 1422]} Length = 202 Back     information, alignment and structure
>d1jvna2 c.23.16.1 (A:-3-229) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]} Length = 232 Back     information, alignment and structure
>d1k9vf_ c.23.16.1 (F:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Length = 200 Back     information, alignment and structure
>d1ka9h_ c.23.16.1 (H:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Length = 195 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query247
d1q7ra_202 Hypothetical protein YaaE {Bacillus stearothermoph 100.0
d2nv0a1195 Hypothetical protein YaaE {Bacillus subtilis [TaxI 100.0
d1jvna2232 GAT subunit, HisH, (or domain) of imidazoleglycero 100.0
d1k9vf_200 GAT subunit, HisH, (or domain) of imidazoleglycero 100.0
d2abwa1218 Pyridoxine biosynthesis protein 2, Pdx2 {Malaria p 99.97
d1ka9h_195 GAT subunit, HisH, (or domain) of imidazoleglycero 99.97
d1wl8a1188 GMP synthase subunit A, GuaAA {Archaeon Pyrococcus 99.95
d2a9va1196 GMP synthase subunit A, GuaAA {Archaeon Thermoplas 99.94
d1qdlb_195 Anthranilate synthase GAT subunit, TrpG {Archaeon 99.91
d1o1ya_230 Hypothetical protein TM1158 {Thermotoga maritima [ 99.91
d1gpma2205 GMP synthetase {Escherichia coli [TaxId: 562]} 99.91
d1a9xb2228 Carbamoyl phosphate synthetase, small subunit C-te 99.89
d1i7qb_192 Anthranilate synthase GAT subunit, TrpG {Serratia 99.88
d1l9xa_288 gamma-glutamyl hydrolase {Human (Homo sapiens) [Ta 99.65
d1s1ma1258 CTP synthase PyrG, C-terminal domain {Escherichia 99.65
d1vcoa1250 CTP synthase PyrG, C-terminal domain {Thermus ther 99.6
d1t3ta2262 FGAM synthase PurL, amidotransferase domain {Salmo 99.44
d2ghra1281 Homoserine O-succinyltransferase HTS (MetA) {Bacil 99.42
d1g2ia_166 Intracellular protease {Archaeon Pyrococcus horiko 99.01
d1p5fa_186 DJ-1 {Human (Homo sapiens) [TaxId: 9606]} 98.82
d2fexa1188 Hypothetical protein Atu0886 {Agrobacterium tumefa 98.8
d1oi4a1170 Hypothetical protein YhbO {Escherichia coli [TaxId 98.8
d1sy7a1184 Catalase, C-terminal domain {Neurospora crassa [Ta 98.75
d1p80a1156 Catalase, C-terminal domain {Escherichia coli, HPI 98.71
d1vhqa_217 Putative sigma cross-reacting protein 27A (SCRP-27 98.61
d2ab0a1195 Protein ThiJ (YajL) {Escherichia coli [TaxId: 562] 98.55
d1u9ca_221 GK2698 ortholog {Bacillus stearothermophilus [TaxI 98.44
d1qvwa_236 Hypothetical protein Ydr533Cp {Baker's yeast (Sacc 97.84
d1fyea_229 Aspartyl dipeptidase PepE {Salmonella typhimurium 97.31
d1n57a_279 HSP31 (HchA; YedU) {Escherichia coli [TaxId: 562]} 97.29
d1z0sa1249 Inorganic polyphosphate/ATP-NAD kinase PpnK {Archa 95.76
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 92.51
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 92.01
d1u0ta_302 Inorganic polyphosphate/ATP-NAD kinase PpnK {Mycob 89.68
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 88.53
d1ydga_201 Trp repressor binding protein WrbA {Deinococcus ra 88.07
d1kwga3197 A4 beta-galactosidase middle domain {Thermus therm 87.68
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 87.32
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 85.76
d1t0ba_240 GK2113 homologue {Bacillus stearothermophilus [Tax 85.33
d2gk3a1246 Putative cytoplasmic protein STM3548 {Salmonella t 82.73
d2c4va1158 Type II 3-dehydroquinate dehydratase {Helicobacter 81.67
>d1q7ra_ c.23.16.1 (A:) Hypothetical protein YaaE {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Class I glutamine amidotransferase-like
family: Class I glutamine amidotransferases (GAT)
domain: Hypothetical protein YaaE
species: Bacillus stearothermophilus [TaxId: 1422]

Probab=100.00  E-value=1.1e-36  Score=254.31  Aligned_cols=190  Identities=48%  Similarity=0.811  Sum_probs=140.3

Q ss_pred             CEEEEEecCCChHHHHHHHHhCCCeEEEECCccCCCCCCEEEECCCchhH-HHHHHhhCCHHHHHHHHHHcCCcEEEEeh
Q 025812            1 MVVGVLALQGSFNEHIAALKRLGVKGVEIRKPDQLQNVSSLIIPGGESTT-MARLAEYHNLFPALREFVKMGKPVWGTCA   79 (247)
Q Consensus         1 m~I~vl~~~G~~~~~~~~L~~~G~~v~~~~~~~~l~~~d~lilpGG~~~~-~~~l~~~~~~~~~i~~~~~~g~PilGIC~   79 (247)
                      ||||||+++||+.+++++|+++|++++++++++++.++|+||||||..+. +..+. ..++.+.|++++++++|+||||+
T Consensus         7 mkIgii~~~Gn~~s~~~al~~~G~~~~~v~~~~~l~~~D~lIlPGG~~~~~~~~l~-~~~l~~~I~~~~~~gkPiLGICl   85 (202)
T d1q7ra_           7 MKIGVLGLQGAVREHVRAIEACGAEAVIVKKSEQLEGLDGLVLPGGESTTMRRLID-RYGLMEPLKQFAAAGKPMFGTCA   85 (202)
T ss_dssp             CEEEEESCGGGCHHHHHHHHHTTCEEEEECSGGGGTTCSEEEECCCCHHHHHHHHH-HTTCHHHHHHHHHTTCCEEEETT
T ss_pred             CEEEEEECCCCHHHHHHHHHHCCCcEEEECCHHHHhcCCEEEECCCCcHHHHHHhh-hhHHHHHHhhhccccceeeeeeh
Confidence            89999999999999999999999999999999999999999999986443 44444 46788999999999999999999


Q ss_pred             hHHHHHHhhhcccCCCcccccceeeEEEeeccCCccccccccccCCcccccCCCCcceeeeeecCceeeecCCCeEEEEE
Q 025812           80 GLIFLANKAVGQKLGGQELVGGLDCTVHRNFFGSQIQSFEAELSVPALASQEGGPETFRGVFIRAPAVLDVGPDVDVLAD  159 (247)
Q Consensus        80 G~QlL~~~~~~~~~g~~~~LG~l~g~v~~~~~g~~~~~~~~~~~v~~~Gw~~~~~~~~~~~~~~~~l~~~l~~~~~~~hs  159 (247)
                      |||+|+..+++   +..+++|++++++.....+....+..........++      ....+|.+++.+..+++.+.++++
T Consensus        86 G~Qll~~~~~~---~~~~~lg~~~~~v~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~~~~~~~~~~a~  156 (202)
T d1q7ra_          86 GLILLAKRIVG---YDEPHLGLMDITVERNSFGRQRESFEAELSIKGVGD------GFVGVFIRAPHIVEAGDGVDVLAT  156 (202)
T ss_dssp             HHHHHEEEEES---SCCCCCCCEEEEEECHHHHCCCCCEEEEEEETTTEE------EEEEEESSCCEEEEECTTCEEEEE
T ss_pred             hhHHhhhhccc---cceeecccccccccccccccccccceeccccccccC------CcceEEEeeccccccccceeEEee
Confidence            99999988754   345789999999876532211110000001111111      112223344444444556666665


Q ss_pred             EeCCCCCCCCCCCCcEEEEEeeCCEEEEeeCCCCCCchHHHHHHHHHHHhccc
Q 025812          160 YPVPSNKENAMPEKKVIVAVRQGNLLGTAFHPELTADTRWHSYFLKMMSEVGE  212 (247)
Q Consensus       160 ~~~~~~~~~~~~~~~~~~~~~~~~i~gvQFHPE~s~~~~i~~nfl~~~~~~~~  212 (247)
                      |.            ..+++++++|++|+|||||+|++.++++||+++|++.+.
T Consensus       157 ~~------------~~~~a~~~gni~G~QFHPEkS~~~~il~~Fl~~~~~~k~  197 (202)
T d1q7ra_         157 YN------------DRIVAARQGQFLGCSFHPELTDDHRLMQYFLNMVKEAKM  197 (202)
T ss_dssp             ET------------TEEEEEEETTEEEESSCGGGSSCCHHHHHHHHHHHHHHH
T ss_pred             cC------------CEEEEEEeCCEEEEEeCCccCCChHHHHHHHHHHHHhhh
Confidence            52            235678899999999999999888899999999987654
>d2nv0a1 c.23.16.1 (A:1-195) Hypothetical protein YaaE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1k9vf_ c.23.16.1 (F:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2abwa1 c.23.16.1 (A:2-219) Pyridoxine biosynthesis protein 2, Pdx2 {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1ka9h_ c.23.16.1 (H:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2a9va1 c.23.16.1 (A:1-196) GMP synthase subunit A, GuaAA {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1qdlb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1o1ya_ c.23.16.1 (A:) Hypothetical protein TM1158 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gpma2 c.23.16.1 (A:3-207) GMP synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a9xb2 c.23.16.1 (B:1653-1880) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i7qb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1l9xa_ c.23.16.1 (A:) gamma-glutamyl hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s1ma1 c.23.16.1 (A:287-544) CTP synthase PyrG, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vcoa1 c.23.16.1 (A:298-547) CTP synthase PyrG, C-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t3ta2 c.23.16.1 (A:1034-1295) FGAM synthase PurL, amidotransferase domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2ghra1 c.23.16.8 (A:17-297) Homoserine O-succinyltransferase HTS (MetA) {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1g2ia_ c.23.16.2 (A:) Intracellular protease {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1p5fa_ c.23.16.2 (A:) DJ-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fexa1 c.23.16.2 (A:1-188) Hypothetical protein Atu0886 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1oi4a1 c.23.16.2 (A:23-192) Hypothetical protein YhbO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sy7a1 c.23.16.3 (A:553-736) Catalase, C-terminal domain {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1p80a1 c.23.16.3 (A:598-753) Catalase, C-terminal domain {Escherichia coli, HPII [TaxId: 562]} Back     information, alignment and structure
>d1vhqa_ c.23.16.2 (A:) Putative sigma cross-reacting protein 27A (SCRP-27A, EllB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ab0a1 c.23.16.2 (A:2-196) Protein ThiJ (YajL) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u9ca_ c.23.16.2 (A:) GK2698 ortholog {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qvwa_ c.23.16.2 (A:) Hypothetical protein Ydr533Cp {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fyea_ c.23.16.4 (A:) Aspartyl dipeptidase PepE {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1n57a_ c.23.16.2 (A:) HSP31 (HchA; YedU) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z0sa1 e.52.1.1 (A:1-249) Inorganic polyphosphate/ATP-NAD kinase PpnK {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u0ta_ e.52.1.1 (A:) Inorganic polyphosphate/ATP-NAD kinase PpnK {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1ydga_ c.23.5.8 (A:) Trp repressor binding protein WrbA {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1kwga3 c.23.16.5 (A:394-590) A4 beta-galactosidase middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t0ba_ c.23.16.6 (A:) GK2113 homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2gk3a1 c.23.16.9 (A:8-253) Putative cytoplasmic protein STM3548 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2c4va1 c.23.13.1 (A:1-158) Type II 3-dehydroquinate dehydratase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure