Citrus Sinensis ID: 025836

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------
MEEKLLRDLTREICSLLSTMASSGLNNGIPPIEQSGHFNRVDVLFLKDLDAFASKSMVGFLLKHKDLALPALQISLEAFTWTDGEAVTKVSSFCSAVVLLAIQSNNIELQQFVSKDLFSAIIRGLALESNAVISADLVGLCREIFIYMCDRDPAPRQVLLSLPCITPQDLLAFEDALTKTASPREQKQHMRSLLVSGTGNNLKALAAQKSVNVITNVSSHAAQIMPQKIELKRGNLLDWRPFREGFL
cHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHcccHHHHHHHHHHHHcccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHcHHHHHHHHHHHHHHHcccccccHHHHHccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccHHHHHHHccccccccccccHHHccccHHHHcccccccccccccccc
MEEKLLRDLTREICSLLSTMASSGL*****************VLFLKDLDAFASKSMVGFLLKHKDLALPALQISLEAFTWTDGEAVTKVSSFCSAVVLLAIQSNNIELQQFVSKDLFSAIIRGLALESNAVISADLVGLCREIFIYMCDRDPAPRQVLLSLPCITPQDLLAFEDAL************MRSLLVSG***NLKALAAQKSVNVITNVSSHAAQIMPQKIELKRGNLLDWRPFREGFL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEEKLLRDLTREICSLLSTMASSGLNNGIPPIEQSGHFNRVDVLFLKDLDAFASKSMVGFLLKHKDLALPALQISLEAFTWTDGEAVTKVSSFCSAVVLLAIQSNNIELQQFVSKDLFSAIIRGLALESNAVISADLVGLCREIFIYMCDRDPAPRQVLLSLPCITPQDLLAFEDALTKTASPREQKQHMRSLLVSGTGNNLKALAAQKSVNVITNVSSHAAQIMPQKIELKRGNLLDWRPFREGFL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein HASTY 1 Nucleocytoplasmic transporter involved in the nuclear export of microRNAs (miRNAs). Required for several miRNAs accumulation. Specifically required for miR156 accumulation which targets SPL3, SPL4 and SPL5 transcription factors. Involved in plant development through its role in miRNAs processing. Required for vegetative phase change and vegetative to reproductive phase transition. Functionally dependent on RAN1 binding. Does not seem to be involved in small interfering RNAs (siRNAs) processing.probableQ0WP44

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2X19, chain B
Confidence level:probable
Coverage over the Query: 68-200
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
3a6p, chain Avery confident Alignment | Template Structure