Citrus Sinensis ID: 025891


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240------
MAQSCAAALSSTAIFAAFCNHFPAESHSSSLRFSPLRLRKMIVSSNRERKCEKFGVKAAYTSDYSSLDDCESTWKGIWSIRNDLEVPSSPYIPTYAQGEQGGGPPPMLLGRFQNVLSQLFQHRIIRCGGPVEDDMANIIVAQLLYLDAVDPNKDIIMYLNSPGGSVTAGMAIFDTIRHIRPDVSTVCVGLAASMGAFLLSAGTKGKRYSLPNSRIMIHQPLGGAQGGQSDIDLQVHIMAYFLTLAF
cccHHHHHHcccHHHcccccccccccccccccccccHHHHHccccccHHHcccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccHHHHHHHHHHcccEEEccccccHHHHHHHHHHHHHHHcccccccEEEEEcccccccccHHHHHHHHccccccccHHHHHHHHHHHHHHHHccccccccccccccEEECccccccccccHHHHHHHHHHHHHHcccc
*********SSTAIFAAFC*****************RLRK*I*S****RKCEKFGVKAAYTSDYSSLDDC*ST*KGI*SIRNDLEVPSSPYIPTYAQG********MLLGRFQNVLSQLFQHRIIRCGGPVEDDMANIIVAQLLYLDAVDPNKDIIMYLNSPGGSVTAGMAIFDTIRHIRPDVSTVCVGLAASMGAFLLSAGTKGKRYSLPNSRIMIHQPLGGAQGGQSDIDLQVHIMAYFLTLAF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAQSCAAALSSTAIFAAFCNHFPAESHSSSLRFSPLRLRKMIVSSNRERKCEKFGVKAAYTSDYSSLDDCESTWKGIWSIRNDLEVPSSPYIPTYAQGEQGGGPPPMLLGRFQNVLSQLFQHRIIRCGGPVEDDMANIIVAQLLYLDAVDPNKDIIMYLNSPGGSVTAGMAIFDTIRHIRPDVSTVCVGLAASMGAFLLSAGTKGKRYSLPNSRIMIHQPLGGAQGGQSDIDLQVHIMAYFLTLAF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ATP-dependent Clp protease proteolytic subunit 5, chloroplastic Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.probableQ9S834
ATP-dependent Clp protease proteolytic subunit Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.probableQ88KJ0
ATP-dependent Clp protease proteolytic subunit Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.probableA5W635

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.4.-.-Acting on peptide bonds (peptide hydrolases).probable
3.4.21.-Serine endopeptidases.probable
3.4.21.92Endopeptidase Clp.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3P2L, chain A
Confidence level:very confident
Coverage over the Query: 110-244
View the alignment between query and template
View the model in PyMOL