Citrus Sinensis ID: 025907
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 246 | ||||||
| 255569506 | 325 | annexin, putative [Ricinus communis] gi| | 0.939 | 0.710 | 0.701 | 1e-97 | |
| 224125822 | 329 | predicted protein [Populus trichocarpa] | 0.967 | 0.723 | 0.670 | 1e-94 | |
| 449446885 | 318 | PREDICTED: annexin D8-like [Cucumis sati | 0.939 | 0.726 | 0.640 | 4e-86 | |
| 449527099 | 317 | PREDICTED: annexin D8-like [Cucumis sati | 0.943 | 0.731 | 0.621 | 1e-83 | |
| 225439272 | 301 | PREDICTED: annexin A3 [Vitis vinifera] g | 0.886 | 0.724 | 0.640 | 6e-80 | |
| 359806450 | 370 | annexin A7-like [Glycine max] gi|2959172 | 0.959 | 0.637 | 0.564 | 2e-72 | |
| 115479499 | 319 | Os09g0453300 [Oryza sativa Japonica Grou | 0.959 | 0.739 | 0.453 | 2e-59 | |
| 356892458 | 320 | annexin [Oryza sativa Indica Group] | 0.959 | 0.737 | 0.452 | 2e-59 | |
| 194696260 | 324 | unknown [Zea mays] gi|195609126|gb|ACG26 | 0.930 | 0.706 | 0.473 | 3e-58 | |
| 242049470 | 336 | hypothetical protein SORBIDRAFT_02g02639 | 0.943 | 0.690 | 0.459 | 8e-57 |
| >gi|255569506|ref|XP_002525720.1| annexin, putative [Ricinus communis] gi|223535020|gb|EEF36703.1| annexin, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 362 bits (928), Expect = 1e-97, Method: Compositional matrix adjust.
Identities = 169/241 (70%), Positives = 198/241 (82%), Gaps = 10/241 (4%)
Query: 7 KNCAALDVWMLGSHERDAAVARQALEESVVNFKALIEILVGRKSSHIALIKQAYQTRYKR 66
K CAAL +WM+ +ERDA VA++ALE+ N++AL+EI VGRKSSHI LIKQAYQ+R++R
Sbjct: 70 KVCAALSMWMINPNERDAIVAKEALEQGYTNYRALVEIFVGRKSSHIMLIKQAYQSRFRR 129
Query: 67 HLDQDIANIEPPHPYQK----------AHNADVSQHVAKCDAKRLYETGEGSPGAAEKAV 116
LDQDI N+EPPHPYQK AH DVSQH+AKCDAKRL+E GEG GA E+AV
Sbjct: 130 QLDQDIINLEPPHPYQKILVALAASHKAHQVDVSQHIAKCDAKRLHEAGEGGSGATEEAV 189
Query: 117 VLEIFSKRSIPQMKLTFSCYKHIYGHDYTKSLKRGNSTDFEDALKMVVKCILNPPNYYAK 176
VLEI SKRSIPQMKLTFS YKHIYGH+YTKSLK+GNS F+DALK V+KC+ PPNYYAK
Sbjct: 190 VLEILSKRSIPQMKLTFSSYKHIYGHEYTKSLKKGNSRAFDDALKTVIKCMCYPPNYYAK 249
Query: 177 TLYASIKGTRVDKAAVARVLVSRAEVDMDEIQRIFKKKYGMELRDAICESIPSGDYRDFL 236
LY SIKG DK A++RV++SRAEVDMDEIQ I KKK+G+ELRDAICES+PSG+YRDFL
Sbjct: 250 ALYTSIKGRTTDKGALSRVMMSRAEVDMDEIQVILKKKHGVELRDAICESVPSGEYRDFL 309
Query: 237 V 237
V
Sbjct: 310 V 310
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224125822|ref|XP_002319683.1| predicted protein [Populus trichocarpa] gi|222858059|gb|EEE95606.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449446885|ref|XP_004141201.1| PREDICTED: annexin D8-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449527099|ref|XP_004170550.1| PREDICTED: annexin D8-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|225439272|ref|XP_002265214.1| PREDICTED: annexin A3 [Vitis vinifera] gi|296089290|emb|CBI39062.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359806450|ref|NP_001241247.1| annexin A7-like [Glycine max] gi|295917227|gb|ADG59900.1| annexin 14 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|115479499|ref|NP_001063343.1| Os09g0453300 [Oryza sativa Japonica Group] gi|51535943|dbj|BAD38025.1| putative fiber annexin [Oryza sativa Japonica Group] gi|113631576|dbj|BAF25257.1| Os09g0453300 [Oryza sativa Japonica Group] gi|215768463|dbj|BAH00692.1| unnamed protein product [Oryza sativa Japonica Group] gi|218202262|gb|EEC84689.1| hypothetical protein OsI_31615 [Oryza sativa Indica Group] gi|222641703|gb|EEE69835.1| hypothetical protein OsJ_29601 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|356892458|gb|AET41707.1| annexin [Oryza sativa Indica Group] | Back alignment and taxonomy information |
|---|
| >gi|194696260|gb|ACF82214.1| unknown [Zea mays] gi|195609126|gb|ACG26393.1| fiber annexin [Zea mays] gi|414589623|tpg|DAA40194.1| TPA: fiber annexin [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|242049470|ref|XP_002462479.1| hypothetical protein SORBIDRAFT_02g026390 [Sorghum bicolor] gi|241925856|gb|EER99000.1| hypothetical protein SORBIDRAFT_02g026390 [Sorghum bicolor] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 246 | ||||||
| RGD|2119 | 324 | Anxa3 "annexin A3" [Rattus nor | 0.869 | 0.660 | 0.383 | 1.8e-30 | |
| MGI|MGI:1201378 | 323 | Anxa3 "annexin A3" [Mus muscul | 0.869 | 0.662 | 0.374 | 4.9e-30 | |
| UNIPROTKB|P12429 | 323 | ANXA3 "Annexin A3" [Homo sapie | 0.869 | 0.662 | 0.378 | 6.2e-30 | |
| UNIPROTKB|D6RA82 | 284 | ANXA3 "Annexin" [Homo sapiens | 0.869 | 0.753 | 0.378 | 6.2e-30 | |
| UNIPROTKB|F1LSV5 | 323 | Anxa3 "Annexin" [Rattus norveg | 0.865 | 0.659 | 0.370 | 2.4e-28 | |
| UNIPROTKB|F1M0L7 | 322 | Anxa3 "Annexin" [Rattus norveg | 0.865 | 0.661 | 0.370 | 2.4e-28 | |
| UNIPROTKB|F1M3H7 | 323 | Anxa3 "Annexin" [Rattus norveg | 0.865 | 0.659 | 0.370 | 2.4e-28 | |
| UNIPROTKB|P20072 | 463 | ANXA7 "Annexin A7" [Bos taurus | 0.873 | 0.464 | 0.336 | 5.7e-28 | |
| UNIPROTKB|E2QXD1 | 488 | ANXA7 "Annexin" [Canis lupus f | 0.873 | 0.440 | 0.336 | 1.6e-27 | |
| UNIPROTKB|E2R0N3 | 323 | ANXA3 "Annexin" [Canis lupus f | 0.841 | 0.640 | 0.372 | 1.7e-27 |
| RGD|2119 Anxa3 "annexin A3" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Score = 336 (123.3 bits), Expect = 1.8e-30, P = 1.8e-30
Identities = 87/227 (38%), Positives = 125/227 (55%)
Query: 23 DAAVARQALEESVVNFKALIEILVGRKSSHIALIKQAYQTRYKRHLDQDIANIEPPHPYQ 82
DA ++++ + LIEIL R S + I QAY T YK++L DI++ E ++
Sbjct: 96 DAKQLKKSMRGMGTDEDTLIEILTTRTSRQMKEISQAYYTAYKKNLRDDISS-ETSGDFR 154
Query: 83 KA----------HNADVSQHVAKCDAKRLYETGEGSPGAAEKAVVLEIFSKRSIPQMKLT 132
KA + V +H+AK DA+ LY+ GE G E EI RS PQ+KLT
Sbjct: 155 KALLTLADGGRDESLKVDEHLAKKDAQTLYDAGEKKWGTDEDKFT-EILCLRSFPQLKLT 213
Query: 133 FSCYKHIYGHDYTKSLKRGNSTDFEDALKMVVKCILNPPNYYAKTLYASIKGTRVDKAAV 192
F Y++I D S+K S FED L VV+C N P + A L+ ++KG D+ +
Sbjct: 214 FDEYRNISQKDIEDSIKGELSGHFEDLLLAVVRCTRNTPAFLAGRLHQALKGAGTDEFTL 273
Query: 193 ARVLVSRAEVDMDEIQRIFKKKYGMELRDAICESIPSGDYRDFLVAL 239
R++VSR+E+D+ +I+R FKK YG L AI +S SGDYR L+ +
Sbjct: 274 NRIMVSRSEIDLLDIRREFKKHYGCSLYSAI-QSDTSGDYRTVLLKI 319
|
|
| MGI|MGI:1201378 Anxa3 "annexin A3" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P12429 ANXA3 "Annexin A3" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D6RA82 ANXA3 "Annexin" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LSV5 Anxa3 "Annexin" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1M0L7 Anxa3 "Annexin" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1M3H7 Anxa3 "Annexin" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P20072 ANXA7 "Annexin A7" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QXD1 ANXA7 "Annexin" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R0N3 ANXA3 "Annexin" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 246 | |||
| pfam00191 | 66 | pfam00191, Annexin, Annexin | 3e-12 | |
| smart00335 | 53 | smart00335, ANX, Annexin repeats | 1e-09 | |
| pfam00191 | 66 | pfam00191, Annexin, Annexin | 5e-08 | |
| pfam00191 | 66 | pfam00191, Annexin, Annexin | 4e-07 | |
| smart00335 | 53 | smart00335, ANX, Annexin repeats | 6e-07 | |
| smart00335 | 53 | smart00335, ANX, Annexin repeats | 4e-05 |
| >gnl|CDD|201070 pfam00191, Annexin, Annexin | Back alignment and domain information |
|---|
Score = 59.8 bits (146), Expect = 3e-12
Identities = 23/67 (34%), Positives = 37/67 (55%), Gaps = 1/67 (1%)
Query: 173 YYAKTLYASIKGTRVDKAAVARVLVSRAEVDMDEIQRIFKKKYGMELRDAICESIPSGDY 232
Y A+ L A++KG D+ + R+L +R+ + I+ +KK YG +L I SGD+
Sbjct: 1 YDAELLRAAMKGLGTDEDTLIRILATRSNAQLQAIREAYKKLYGKDLEKDIKSET-SGDF 59
Query: 233 RDFLVAL 239
L+AL
Sbjct: 60 EKLLLAL 66
|
This family of annexins also includes giardin that has been shown to function as an annexin. Length = 66 |
| >gnl|CDD|197661 smart00335, ANX, Annexin repeats | Back alignment and domain information |
|---|
| >gnl|CDD|201070 pfam00191, Annexin, Annexin | Back alignment and domain information |
|---|
| >gnl|CDD|201070 pfam00191, Annexin, Annexin | Back alignment and domain information |
|---|
| >gnl|CDD|197661 smart00335, ANX, Annexin repeats | Back alignment and domain information |
|---|
| >gnl|CDD|197661 smart00335, ANX, Annexin repeats | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 246 | |||
| KOG0819 | 321 | consensus Annexin [Intracellular trafficking, secr | 100.0 | |
| KOG0819 | 321 | consensus Annexin [Intracellular trafficking, secr | 100.0 | |
| PF00191 | 66 | Annexin: Annexin; InterPro: IPR018502 The annexins | 99.74 | |
| PF00191 | 66 | Annexin: Annexin; InterPro: IPR018502 The annexins | 99.67 | |
| smart00335 | 53 | ANX Annexin repeats. | 99.44 | |
| smart00335 | 53 | ANX Annexin repeats. | 99.4 |
| >KOG0819 consensus Annexin [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.1e-65 Score=435.97 Aligned_cols=237 Identities=37% Similarity=0.557 Sum_probs=230.0
Q ss_pred ChhhHHHHHHHHcCCChHHHHHHHHHHHhcCCCCHHHHHHHHhCCCHHHHHHHHHHHHHhhccCHHHHhhccCCCCcccc
Q 025907 4 FLPKNCAALDVWMLGSHERDAAVARQALEESVVNFKALIEILVGRKSSHIALIKQAYQTRYKRHLDQDIANIEPPHPYQK 83 (246)
Q Consensus 4 ~~~~~~~~l~~l~~~~~~~da~~L~~A~~g~g~de~~li~iL~~rs~~e~~~I~~~Y~~~~~~~L~~~i~~~~~~g~~~~ 83 (246)
++|+|++++++|+.||+++||++|++||+|.|||+.+||||||+|||.|+++|+++|+..|+++|++||. +++||+|++
T Consensus 74 LsG~Fe~~i~al~~~p~~~DA~~l~~amkg~gtde~vlIEIlcTRT~~el~~i~~aY~~~y~~sLEeDI~-s~TSG~frk 152 (321)
T KOG0819|consen 74 LSGDFERAIVALMKPPAEYDAKELKKAMKGLGTDEKVLIEILCTRTNEELRAIRQAYQELYKKSLEEDIA-SDTSGDFRK 152 (321)
T ss_pred hCccHHHHHHHHcCCHHHhHHHHHHHHHhccCcchhhheeeeccCCHHHHHHHHHHHHHHHcccHHHHhh-hccCchHHH
Confidence 6899999999999999999999999999999999999999999999999999999999999999999999 999999999
Q ss_pred cc----------ccccchhHHHHHHHHHHhhcCCCCCCChHHHHHHHhhcCCHHHHHHHHHHHHHHhCCCHHHHHhhcCC
Q 025907 84 AH----------NADVSQHVAKCDAKRLYETGEGSPGAAEKAVVLEIFSKRSIPQMKLTFSCYKHIYGHDYTKSLKRGNS 153 (246)
Q Consensus 84 ~~----------~~~~~~~~~~~da~~L~~A~~g~~g~td~~~li~Il~~rs~~~l~~I~~~Y~~~~g~~L~~~I~~~~~ 153 (246)
.+ ...++...++.||+.|++|++.+|| ||+..++.||++||.+|++.+++.|+..+|+++++.|+.+++
T Consensus 153 lLv~L~~~~R~e~~~vd~~la~~dA~~L~~Age~k~g-tde~~~~~Il~tRs~~qL~~vf~~y~~~~g~diek~I~~e~~ 231 (321)
T KOG0819|consen 153 LLVSLVQGNRDEGDRVDDALAKQDAQDLYEAGEKKWG-TDEDKFIRILTTRSKAQLRLVFEEYQRISGKDIEKSIKEEFS 231 (321)
T ss_pred HHHHHHhcCCccCCCcCHHHHHHHHHHHHHHhhhhcc-CcHHHHHHHHHhCCHHHHHHHHHHHHHhcchhHHHHHhhccC
Confidence 32 2357889999999999999999998 999999999999999999999999999999999999999999
Q ss_pred CchHHHHHHHHHhhCCchHHHHHHHHHhhcCCCCCHHHHHHHHHhCCHHHHHHHHHHHHHhhCccHHHHhhccCCChHHH
Q 025907 154 TDFEDALKMVVKCILNPPNYYAKTLYASIKGTRVDKAAVARVLVSRAEVDMDEIQRIFKKKYGMELRDAICESIPSGDYR 233 (246)
Q Consensus 154 g~~~~~l~~~~~~~~~~~~~~A~~L~~a~~g~gtd~~~li~il~~rs~~~l~~i~~~Y~~~yg~~L~~~I~~~~~~G~~~ 233 (246)
|+++++|++++.|.+|||.|||+.||.||+|.|||+.+||||+|+||+.||..|+.+|+++||+||.++|..+ |||||+
T Consensus 232 gd~~~~llaiv~c~~n~~~yFA~~L~~amkg~GTdd~~LiRI~VsRsEiDl~~Ik~ef~~~Y~ksL~~~I~~d-tsGdY~ 310 (321)
T KOG0819|consen 232 GDFEKLLLAIVKCIRNPPAYFAERLRKAMKGLGTDDKTLIRIVVSRSEIDLLDIKEEFQRKYGKSLYSAIKGD-TSGDYK 310 (321)
T ss_pred chHHHHHHHHHHHHcCHHHHHHHHHHHHHhccCCCccceeeeeeeHHHhhHHHHHHHHHHHhCccHHHHHhhh-ccchHH
Confidence 9999999999999999999999999999999999999999999999999999999999999999999999999 899999
Q ss_pred HHHHHHhccc
Q 025907 234 DFLVALATKA 243 (246)
Q Consensus 234 ~~Ll~l~~~~ 243 (246)
++|++||++.
T Consensus 311 ~~LlaL~g~~ 320 (321)
T KOG0819|consen 311 KALLALLGGD 320 (321)
T ss_pred HHHHHHhCCC
Confidence 9999999875
|
|
| >KOG0819 consensus Annexin [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF00191 Annexin: Annexin; InterPro: IPR018502 The annexins (or lipocortins) are a family of proteins that bind to phospholipids in a calcium-dependent manner [] | Back alignment and domain information |
|---|
| >PF00191 Annexin: Annexin; InterPro: IPR018502 The annexins (or lipocortins) are a family of proteins that bind to phospholipids in a calcium-dependent manner [] | Back alignment and domain information |
|---|
| >smart00335 ANX Annexin repeats | Back alignment and domain information |
|---|
| >smart00335 ANX Annexin repeats | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 246 | ||||
| 1axn_A | 323 | The High Resolution Structure Of Annexin Iii Shows | 4e-32 | ||
| 1aii_A | 323 | Annexin Iii Length = 323 | 5e-32 | ||
| 2zhi_A | 322 | Crystal Structure Analysis Of The Sodium-Bound Anne | 7e-29 | ||
| 2zhi_A | 322 | Crystal Structure Analysis Of The Sodium-Bound Anne | 1e-05 | ||
| 1aow_A | 309 | Annexin Iv Length = 309 | 5e-27 | ||
| 1aow_A | 309 | Annexin Iv Length = 309 | 1e-04 | ||
| 1ann_A | 318 | Annexin Iv Length = 318 | 6e-27 | ||
| 1ann_A | 318 | Annexin Iv Length = 318 | 4e-05 | ||
| 1i4a_A | 318 | Crystal Structure Of Phosphorylation-Mimicking Muta | 6e-27 | ||
| 1i4a_A | 318 | Crystal Structure Of Phosphorylation-Mimicking Muta | 4e-05 | ||
| 2zoc_A | 319 | Crystal Structure Of Recombinant Human Annexin Iv L | 1e-26 | ||
| 2zoc_A | 319 | Crystal Structure Of Recombinant Human Annexin Iv L | 4e-05 | ||
| 1ala_A | 321 | Structure Of Chicken Annexin V At 2.25-Angstroms Re | 4e-25 | ||
| 1yii_A | 320 | Crystal Structures Of Chicken Annexin V In Complex | 4e-25 | ||
| 1hm6_A | 346 | X-Ray Structure Of Full-Length Annexin 1 Length = 3 | 5e-25 | ||
| 1hm6_A | 346 | X-Ray Structure Of Full-Length Annexin 1 Length = 3 | 1e-07 | ||
| 1ain_A | 314 | Crystal Structure Of Human Annexin I At 2.5 Angstro | 5e-25 | ||
| 1ain_A | 314 | Crystal Structure Of Human Annexin I At 2.5 Angstro | 2e-07 | ||
| 3brx_A | 317 | Crystal Structure Of Calcium-Bound Cotton Annexin G | 2e-24 | ||
| 1n00_A | 321 | Annexin Gh1 From Cotton Length = 321 | 2e-24 | ||
| 1ycn_A | 317 | X-Ray Structure Of Annexin From Arabidopsis Thalian | 2e-23 | ||
| 1ycn_A | 317 | X-Ray Structure Of Annexin From Arabidopsis Thalian | 5e-05 | ||
| 1hvf_A | 319 | Structural And Electrophysiological Analysis Of Ann | 6e-23 | ||
| 1hvf_A | 319 | Structural And Electrophysiological Analysis Of Ann | 1e-05 | ||
| 1hve_A | 319 | Structural And Electrophysiological Analysis Of Ann | 6e-23 | ||
| 1hve_A | 319 | Structural And Electrophysiological Analysis Of Ann | 1e-05 | ||
| 1hvd_A | 319 | Structural And Electrophysiological Analysis Of Ann | 7e-23 | ||
| 1hvd_A | 319 | Structural And Electrophysiological Analysis Of Ann | 4e-06 | ||
| 1avh_A | 320 | Crystal And Molecular Structure Of Human Annexin V | 7e-23 | ||
| 1avh_A | 320 | Crystal And Molecular Structure Of Human Annexin V | 5e-06 | ||
| 1anw_A | 319 | The Effect Of Metal Binding On The Structure Of Ann | 7e-23 | ||
| 1anw_A | 319 | The Effect Of Metal Binding On The Structure Of Ann | 5e-06 | ||
| 1bcw_A | 319 | Recombinant Rat Annexin V, T72a Mutant Length = 319 | 2e-22 | ||
| 1bc0_A | 319 | Recombinant Rat Annexin V, W185a Mutant Length = 31 | 2e-22 | ||
| 1bc0_A | 319 | Recombinant Rat Annexin V, W185a Mutant Length = 31 | 9e-06 | ||
| 2h0k_A | 318 | Crystal Structure Of A Mutant Of Rat Annexin A5 Len | 2e-22 | ||
| 2h0k_A | 318 | Crystal Structure Of A Mutant Of Rat Annexin A5 Len | 7e-06 | ||
| 2h0m_A | 318 | Structure Of A Mutant Of Rat Annexin A5 Length = 31 | 2e-22 | ||
| 2h0m_A | 318 | Structure Of A Mutant Of Rat Annexin A5 Length = 31 | 8e-06 | ||
| 1m9i_A | 672 | Crystal Structure Of Phosphorylation-Mimicking Muta | 3e-22 | ||
| 1m9i_A | 672 | Crystal Structure Of Phosphorylation-Mimicking Muta | 1e-06 | ||
| 2xo2_A | 320 | Human Annexin V With Incorporated Methionine Analog | 3e-22 | ||
| 2xo2_A | 320 | Human Annexin V With Incorporated Methionine Analog | 1e-05 | ||
| 1sav_A | 320 | Human Annexin V With Proline Substitution By Thiopr | 3e-22 | ||
| 1sav_A | 320 | Human Annexin V With Proline Substitution By Thiopr | 3e-06 | ||
| 1g5n_A | 318 | Annexin V Complex With Heparin Oligosaccharides Len | 3e-22 | ||
| 1g5n_A | 318 | Annexin V Complex With Heparin Oligosaccharides Len | 8e-06 | ||
| 1a8a_A | 319 | Rat Annexin V Complexed With Glycerophosphoserine L | 3e-22 | ||
| 1a8a_A | 319 | Rat Annexin V Complexed With Glycerophosphoserine L | 8e-06 | ||
| 1n41_A | 319 | Crystal Structure Of Annexin V K27e Mutant Length = | 3e-22 | ||
| 1n41_A | 319 | Crystal Structure Of Annexin V K27e Mutant Length = | 2e-06 | ||
| 2h0l_A | 318 | Crystal Structure Of A Mutant Of Rat Annexin A5 Len | 3e-22 | ||
| 2h0l_A | 318 | Crystal Structure Of A Mutant Of Rat Annexin A5 Len | 3e-06 | ||
| 1bcz_A | 319 | Recombinant Rat Annexin V, T72s Mutant Length = 319 | 3e-22 | ||
| 1bcz_A | 319 | Recombinant Rat Annexin V, T72s Mutant Length = 319 | 4e-06 | ||
| 1n44_A | 319 | Crystal Structure Of Annexin V R23e Mutant Length = | 4e-22 | ||
| 1n44_A | 319 | Crystal Structure Of Annexin V R23e Mutant Length = | 8e-06 | ||
| 1bcy_A | 319 | Recombinant Rat Annexin V, T72k Mutant Length = 319 | 4e-22 | ||
| 1bcy_A | 319 | Recombinant Rat Annexin V, T72k Mutant Length = 319 | 2e-05 | ||
| 2ran_A | 316 | Rat Annexin V Crystal Structure: Ca2+-Induced Confo | 4e-22 | ||
| 2ran_A | 316 | Rat Annexin V Crystal Structure: Ca2+-Induced Confo | 8e-06 | ||
| 1n42_A | 319 | Crystal Structure Of Annexin V R149e Mutant Length | 5e-22 | ||
| 1n42_A | 319 | Crystal Structure Of Annexin V R149e Mutant Length | 3e-06 | ||
| 1avc_A | 673 | Bovine Annexin Vi (Calcium-Bound) Length = 673 | 1e-21 | ||
| 1avc_A | 673 | Bovine Annexin Vi (Calcium-Bound) Length = 673 | 6e-06 | ||
| 1bc3_A | 319 | Recombinant Rat Annexin V, Triple Mutant (T72k, S14 | 2e-21 | ||
| 1bc3_A | 319 | Recombinant Rat Annexin V, Triple Mutant (T72k, S14 | 6e-05 | ||
| 1bc1_A | 319 | Recombinant Rat Annexin V, Quadruple Mutant (T72k, | 6e-21 | ||
| 1bc1_A | 319 | Recombinant Rat Annexin V, Quadruple Mutant (T72k, | 6e-05 | ||
| 1w7b_A | 339 | Annexin A2: Does It Induce Membrane Aggregation By | 2e-20 | ||
| 1w7b_A | 339 | Annexin A2: Does It Induce Membrane Aggregation By | 4e-08 | ||
| 2hyu_A | 308 | Human Annexin A2 With Heparin Tetrasaccharide Bound | 2e-20 | ||
| 2hyu_A | 308 | Human Annexin A2 With Heparin Tetrasaccharide Bound | 4e-08 | ||
| 1xjl_A | 319 | Structure Of Human Annexin A2 In The Presence Of Ca | 2e-20 | ||
| 1xjl_A | 319 | Structure Of Human Annexin A2 In The Presence Of Ca | 5e-08 | ||
| 1dk5_A | 322 | Crystal Structure Of Annexin 24(Ca32) From Capsicum | 3e-19 | ||
| 1w45_A | 327 | The 2.5 Angstroem Structure Of The K16a Mutant Of A | 1e-18 | ||
| 1w3w_A | 327 | The 2.1 Angstroem Resolution Structure Of Annexin A | 1e-18 | ||
| 1aei_A | 315 | Crystal Structure Of The Annexin Xii Hexamer Length | 7e-18 | ||
| 1dm5_A | 315 | Annexin Xii E105k Homohexamer Crystal Structure Len | 7e-18 |
| >pdb|1AXN|A Chain A, The High Resolution Structure Of Annexin Iii Shows Differences With Annexin V Length = 323 | Back alignment and structure |
|
| >pdb|1AII|A Chain A, Annexin Iii Length = 323 | Back alignment and structure |
| >pdb|2ZHI|A Chain A, Crystal Structure Analysis Of The Sodium-Bound Annexin A4 At 1.58 A Resolution Length = 322 | Back alignment and structure |
| >pdb|2ZHI|A Chain A, Crystal Structure Analysis Of The Sodium-Bound Annexin A4 At 1.58 A Resolution Length = 322 | Back alignment and structure |
| >pdb|1AOW|A Chain A, Annexin Iv Length = 309 | Back alignment and structure |
| >pdb|1AOW|A Chain A, Annexin Iv Length = 309 | Back alignment and structure |
| >pdb|1ANN|A Chain A, Annexin Iv Length = 318 | Back alignment and structure |
| >pdb|1ANN|A Chain A, Annexin Iv Length = 318 | Back alignment and structure |
| >pdb|1I4A|A Chain A, Crystal Structure Of Phosphorylation-Mimicking Mutant T6d Of Annexin Iv Length = 318 | Back alignment and structure |
| >pdb|1I4A|A Chain A, Crystal Structure Of Phosphorylation-Mimicking Mutant T6d Of Annexin Iv Length = 318 | Back alignment and structure |
| >pdb|2ZOC|A Chain A, Crystal Structure Of Recombinant Human Annexin Iv Length = 319 | Back alignment and structure |
| >pdb|2ZOC|A Chain A, Crystal Structure Of Recombinant Human Annexin Iv Length = 319 | Back alignment and structure |
| >pdb|1ALA|A Chain A, Structure Of Chicken Annexin V At 2.25-Angstroms Resolution Length = 321 | Back alignment and structure |
| >pdb|1YII|A Chain A, Crystal Structures Of Chicken Annexin V In Complex With Ca2+ Length = 320 | Back alignment and structure |
| >pdb|1HM6|A Chain A, X-Ray Structure Of Full-Length Annexin 1 Length = 346 | Back alignment and structure |
| >pdb|1HM6|A Chain A, X-Ray Structure Of Full-Length Annexin 1 Length = 346 | Back alignment and structure |
| >pdb|1AIN|A Chain A, Crystal Structure Of Human Annexin I At 2.5 Angstroms Resolution Length = 314 | Back alignment and structure |
| >pdb|1AIN|A Chain A, Crystal Structure Of Human Annexin I At 2.5 Angstroms Resolution Length = 314 | Back alignment and structure |
| >pdb|3BRX|A Chain A, Crystal Structure Of Calcium-Bound Cotton Annexin Gh1 Length = 317 | Back alignment and structure |
| >pdb|1N00|A Chain A, Annexin Gh1 From Cotton Length = 321 | Back alignment and structure |
| >pdb|1YCN|A Chain A, X-Ray Structure Of Annexin From Arabidopsis Thaliana Gene At1g35720 Length = 317 | Back alignment and structure |
| >pdb|1YCN|A Chain A, X-Ray Structure Of Annexin From Arabidopsis Thaliana Gene At1g35720 Length = 317 | Back alignment and structure |
| >pdb|1HVF|A Chain A, Structural And Electrophysiological Analysis Of Annexin V Mutants. Mutagenesis Of Human Annexin V, An In Vitro Voltage-Gated Calcium Channel, Provides Information About The Structural Features Of The Ion Pathway, The Voltage Sensor And The Ion Selectivity Filter Length = 319 | Back alignment and structure |
| >pdb|1HVF|A Chain A, Structural And Electrophysiological Analysis Of Annexin V Mutants. Mutagenesis Of Human Annexin V, An In Vitro Voltage-Gated Calcium Channel, Provides Information About The Structural Features Of The Ion Pathway, The Voltage Sensor And The Ion Selectivity Filter Length = 319 | Back alignment and structure |
| >pdb|1HVE|A Chain A, Structural And Electrophysiological Analysis Of Annexin V Mutants. Mutagenesis Of Human Annexin V, An In Vitro Voltage-Gated Calcium Channel, Provides Information About The Structural Features Of The Ion Pathway, The Voltage Sensor And The Ion Selectivity Filter Length = 319 | Back alignment and structure |
| >pdb|1HVE|A Chain A, Structural And Electrophysiological Analysis Of Annexin V Mutants. Mutagenesis Of Human Annexin V, An In Vitro Voltage-Gated Calcium Channel, Provides Information About The Structural Features Of The Ion Pathway, The Voltage Sensor And The Ion Selectivity Filter Length = 319 | Back alignment and structure |
| >pdb|1HVD|A Chain A, Structural And Electrophysiological Analysis Of Annexin V Mutants. Mutagenesis Of Human Annexin V, An In Vitro Voltage-Gated Calcium Channel, Provides Information About The Structural Features Of The Ion Pathway, The Voltage Sensor And The Ion Selectivity Filter Length = 319 | Back alignment and structure |
| >pdb|1HVD|A Chain A, Structural And Electrophysiological Analysis Of Annexin V Mutants. Mutagenesis Of Human Annexin V, An In Vitro Voltage-Gated Calcium Channel, Provides Information About The Structural Features Of The Ion Pathway, The Voltage Sensor And The Ion Selectivity Filter Length = 319 | Back alignment and structure |
| >pdb|1AVH|A Chain A, Crystal And Molecular Structure Of Human Annexin V After Refinement. Implications For Structure, Membrane Binding And Ion Channel Formation Of The Annexin Family Of Proteins Length = 320 | Back alignment and structure |
| >pdb|1AVH|A Chain A, Crystal And Molecular Structure Of Human Annexin V After Refinement. Implications For Structure, Membrane Binding And Ion Channel Formation Of The Annexin Family Of Proteins Length = 320 | Back alignment and structure |
| >pdb|1ANW|A Chain A, The Effect Of Metal Binding On The Structure Of Annexin V And Implications For Membrane Binding Length = 319 | Back alignment and structure |
| >pdb|1ANW|A Chain A, The Effect Of Metal Binding On The Structure Of Annexin V And Implications For Membrane Binding Length = 319 | Back alignment and structure |
| >pdb|1BCW|A Chain A, Recombinant Rat Annexin V, T72a Mutant Length = 319 | Back alignment and structure |
| >pdb|1BC0|A Chain A, Recombinant Rat Annexin V, W185a Mutant Length = 319 | Back alignment and structure |
| >pdb|1BC0|A Chain A, Recombinant Rat Annexin V, W185a Mutant Length = 319 | Back alignment and structure |
| >pdb|2H0K|A Chain A, Crystal Structure Of A Mutant Of Rat Annexin A5 Length = 318 | Back alignment and structure |
| >pdb|2H0K|A Chain A, Crystal Structure Of A Mutant Of Rat Annexin A5 Length = 318 | Back alignment and structure |
| >pdb|2H0M|A Chain A, Structure Of A Mutant Of Rat Annexin A5 Length = 318 | Back alignment and structure |
| >pdb|2H0M|A Chain A, Structure Of A Mutant Of Rat Annexin A5 Length = 318 | Back alignment and structure |
| >pdb|1M9I|A Chain A, Crystal Structure Of Phosphorylation-Mimicking Mutant T356d Of Annexin Vi Length = 672 | Back alignment and structure |
| >pdb|1M9I|A Chain A, Crystal Structure Of Phosphorylation-Mimicking Mutant T356d Of Annexin Vi Length = 672 | Back alignment and structure |
| >pdb|2XO2|A Chain A, Human Annexin V With Incorporated Methionine Analogue Azidohomoalanine Length = 320 | Back alignment and structure |
| >pdb|2XO2|A Chain A, Human Annexin V With Incorporated Methionine Analogue Azidohomoalanine Length = 320 | Back alignment and structure |
| >pdb|1SAV|A Chain A, Human Annexin V With Proline Substitution By Thioproline Length = 320 | Back alignment and structure |
| >pdb|1SAV|A Chain A, Human Annexin V With Proline Substitution By Thioproline Length = 320 | Back alignment and structure |
| >pdb|1G5N|A Chain A, Annexin V Complex With Heparin Oligosaccharides Length = 318 | Back alignment and structure |
| >pdb|1G5N|A Chain A, Annexin V Complex With Heparin Oligosaccharides Length = 318 | Back alignment and structure |
| >pdb|1A8A|A Chain A, Rat Annexin V Complexed With Glycerophosphoserine Length = 319 | Back alignment and structure |
| >pdb|1A8A|A Chain A, Rat Annexin V Complexed With Glycerophosphoserine Length = 319 | Back alignment and structure |
| >pdb|1N41|A Chain A, Crystal Structure Of Annexin V K27e Mutant Length = 319 | Back alignment and structure |
| >pdb|1N41|A Chain A, Crystal Structure Of Annexin V K27e Mutant Length = 319 | Back alignment and structure |
| >pdb|2H0L|A Chain A, Crystal Structure Of A Mutant Of Rat Annexin A5 Length = 318 | Back alignment and structure |
| >pdb|2H0L|A Chain A, Crystal Structure Of A Mutant Of Rat Annexin A5 Length = 318 | Back alignment and structure |
| >pdb|1BCZ|A Chain A, Recombinant Rat Annexin V, T72s Mutant Length = 319 | Back alignment and structure |
| >pdb|1BCZ|A Chain A, Recombinant Rat Annexin V, T72s Mutant Length = 319 | Back alignment and structure |
| >pdb|1N44|A Chain A, Crystal Structure Of Annexin V R23e Mutant Length = 319 | Back alignment and structure |
| >pdb|1N44|A Chain A, Crystal Structure Of Annexin V R23e Mutant Length = 319 | Back alignment and structure |
| >pdb|1BCY|A Chain A, Recombinant Rat Annexin V, T72k Mutant Length = 319 | Back alignment and structure |
| >pdb|1BCY|A Chain A, Recombinant Rat Annexin V, T72k Mutant Length = 319 | Back alignment and structure |
| >pdb|2RAN|A Chain A, Rat Annexin V Crystal Structure: Ca2+-Induced Conformational Changes Length = 316 | Back alignment and structure |
| >pdb|2RAN|A Chain A, Rat Annexin V Crystal Structure: Ca2+-Induced Conformational Changes Length = 316 | Back alignment and structure |
| >pdb|1N42|A Chain A, Crystal Structure Of Annexin V R149e Mutant Length = 319 | Back alignment and structure |
| >pdb|1N42|A Chain A, Crystal Structure Of Annexin V R149e Mutant Length = 319 | Back alignment and structure |
| >pdb|1AVC|A Chain A, Bovine Annexin Vi (Calcium-Bound) Length = 673 | Back alignment and structure |
| >pdb|1AVC|A Chain A, Bovine Annexin Vi (Calcium-Bound) Length = 673 | Back alignment and structure |
| >pdb|1BC3|A Chain A, Recombinant Rat Annexin V, Triple Mutant (T72k, S144k, S228k) Length = 319 | Back alignment and structure |
| >pdb|1BC3|A Chain A, Recombinant Rat Annexin V, Triple Mutant (T72k, S144k, S228k) Length = 319 | Back alignment and structure |
| >pdb|1BC1|A Chain A, Recombinant Rat Annexin V, Quadruple Mutant (T72k, S144k, S228k, S303k) Length = 319 | Back alignment and structure |
| >pdb|1BC1|A Chain A, Recombinant Rat Annexin V, Quadruple Mutant (T72k, S144k, S228k, S303k) Length = 319 | Back alignment and structure |
| >pdb|1W7B|A Chain A, Annexin A2: Does It Induce Membrane Aggregation By A New Multimeric State Of The Protein Length = 339 | Back alignment and structure |
| >pdb|1W7B|A Chain A, Annexin A2: Does It Induce Membrane Aggregation By A New Multimeric State Of The Protein Length = 339 | Back alignment and structure |
| >pdb|2HYU|A Chain A, Human Annexin A2 With Heparin Tetrasaccharide Bound Length = 308 | Back alignment and structure |
| >pdb|2HYU|A Chain A, Human Annexin A2 With Heparin Tetrasaccharide Bound Length = 308 | Back alignment and structure |
| >pdb|1XJL|A Chain A, Structure Of Human Annexin A2 In The Presence Of Calcium Ions Length = 319 | Back alignment and structure |
| >pdb|1XJL|A Chain A, Structure Of Human Annexin A2 In The Presence Of Calcium Ions Length = 319 | Back alignment and structure |
| >pdb|1DK5|A Chain A, Crystal Structure Of Annexin 24(Ca32) From Capsicum Annuum Length = 322 | Back alignment and structure |
| >pdb|1W45|A Chain A, The 2.5 Angstroem Structure Of The K16a Mutant Of Annexin A8, Which Has An Intact N-Terminus. Length = 327 | Back alignment and structure |
| >pdb|1W3W|A Chain A, The 2.1 Angstroem Resolution Structure Of Annexin A8 Length = 327 | Back alignment and structure |
| >pdb|1AEI|A Chain A, Crystal Structure Of The Annexin Xii Hexamer Length = 315 | Back alignment and structure |
| >pdb|1DM5|A Chain A, Annexin Xii E105k Homohexamer Crystal Structure Length = 315 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 246 | |||
| 1n00_A | 321 | Annexin GH1; membrane-binding, calcium-binding, me | 5e-62 | |
| 1n00_A | 321 | Annexin GH1; membrane-binding, calcium-binding, me | 3e-21 | |
| 1n00_A | 321 | Annexin GH1; membrane-binding, calcium-binding, me | 2e-12 | |
| 1n00_A | 321 | Annexin GH1; membrane-binding, calcium-binding, me | 6e-08 | |
| 1w3w_A | 327 | Annexin A8; coagulation, annexin family, calcium a | 6e-60 | |
| 1w3w_A | 327 | Annexin A8; coagulation, annexin family, calcium a | 2e-21 | |
| 1w3w_A | 327 | Annexin A8; coagulation, annexin family, calcium a | 3e-20 | |
| 1w3w_A | 327 | Annexin A8; coagulation, annexin family, calcium a | 3e-08 | |
| 1w3w_A | 327 | Annexin A8; coagulation, annexin family, calcium a | 5e-05 | |
| 1hm6_A | 346 | Annexin 1; phospholipid/Ca(2+)-binding protein, ca | 1e-59 | |
| 1hm6_A | 346 | Annexin 1; phospholipid/Ca(2+)-binding protein, ca | 4e-18 | |
| 1hm6_A | 346 | Annexin 1; phospholipid/Ca(2+)-binding protein, ca | 6e-08 | |
| 2hyv_A | 308 | Annexin A2; calcium-binding protein, membrane-bind | 3e-59 | |
| 2hyv_A | 308 | Annexin A2; calcium-binding protein, membrane-bind | 1e-21 | |
| 2hyv_A | 308 | Annexin A2; calcium-binding protein, membrane-bind | 9e-21 | |
| 2hyv_A | 308 | Annexin A2; calcium-binding protein, membrane-bind | 4e-09 | |
| 2hyv_A | 308 | Annexin A2; calcium-binding protein, membrane-bind | 4e-06 | |
| 1axn_A | 323 | Annexin III; annexin family, calcium/phospholipid- | 2e-57 | |
| 1axn_A | 323 | Annexin III; annexin family, calcium/phospholipid- | 5e-23 | |
| 1axn_A | 323 | Annexin III; annexin family, calcium/phospholipid- | 5e-18 | |
| 1axn_A | 323 | Annexin III; annexin family, calcium/phospholipid- | 5e-08 | |
| 1axn_A | 323 | Annexin III; annexin family, calcium/phospholipid- | 8e-07 | |
| 2zhj_A | 322 | Annexin A4; zynogen granule, membrane binding prot | 2e-57 | |
| 2zhj_A | 322 | Annexin A4; zynogen granule, membrane binding prot | 1e-21 | |
| 2zhj_A | 322 | Annexin A4; zynogen granule, membrane binding prot | 1e-18 | |
| 2zhj_A | 322 | Annexin A4; zynogen granule, membrane binding prot | 2e-07 | |
| 2zhj_A | 322 | Annexin A4; zynogen granule, membrane binding prot | 1e-05 | |
| 1yii_A | 320 | Annexin A5, annexin V, lipocortin V, endonexin II; | 2e-57 | |
| 1yii_A | 320 | Annexin A5, annexin V, lipocortin V, endonexin II; | 2e-18 | |
| 1yii_A | 320 | Annexin A5, annexin V, lipocortin V, endonexin II; | 2e-07 | |
| 1yii_A | 320 | Annexin A5, annexin V, lipocortin V, endonexin II; | 3e-07 | |
| 1yii_A | 320 | Annexin A5, annexin V, lipocortin V, endonexin II; | 6e-06 | |
| 1dm5_A | 315 | Annexin XII E105K mutant homohexamer; novel PH-dep | 3e-57 | |
| 1dm5_A | 315 | Annexin XII E105K mutant homohexamer; novel PH-dep | 3e-19 | |
| 1dm5_A | 315 | Annexin XII E105K mutant homohexamer; novel PH-dep | 4e-17 | |
| 1dm5_A | 315 | Annexin XII E105K mutant homohexamer; novel PH-dep | 3e-08 | |
| 1dm5_A | 315 | Annexin XII E105K mutant homohexamer; novel PH-dep | 6e-06 | |
| 1m9i_A | 672 | Annexin VI; calcium-binding, membrane-binding, pho | 6e-56 | |
| 1m9i_A | 672 | Annexin VI; calcium-binding, membrane-binding, pho | 3e-54 | |
| 1m9i_A | 672 | Annexin VI; calcium-binding, membrane-binding, pho | 2e-27 | |
| 1m9i_A | 672 | Annexin VI; calcium-binding, membrane-binding, pho | 2e-18 | |
| 1m9i_A | 672 | Annexin VI; calcium-binding, membrane-binding, pho | 2e-17 | |
| 1m9i_A | 672 | Annexin VI; calcium-binding, membrane-binding, pho | 6e-17 | |
| 1m9i_A | 672 | Annexin VI; calcium-binding, membrane-binding, pho | 9e-08 | |
| 1m9i_A | 672 | Annexin VI; calcium-binding, membrane-binding, pho | 1e-06 | |
| 2ii2_A | 310 | Alpha-11 giardin; helix-turn-helix, metal binding | 1e-55 | |
| 2ii2_A | 310 | Alpha-11 giardin; helix-turn-helix, metal binding | 3e-20 | |
| 2ii2_A | 310 | Alpha-11 giardin; helix-turn-helix, metal binding | 9e-07 | |
| 3chj_A | 337 | Alpha-14 giardin; calcium-binding, annexin, metal | 4e-55 | |
| 3chj_A | 337 | Alpha-14 giardin; calcium-binding, annexin, metal | 1e-15 | |
| 3chj_A | 337 | Alpha-14 giardin; calcium-binding, annexin, metal | 6e-14 | |
| 3chj_A | 337 | Alpha-14 giardin; calcium-binding, annexin, metal | 4e-09 | |
| 4evf_A | 295 | Alpha-1 giardin, giardin subunit alpha-1; annexin, | 1e-50 | |
| 4evf_A | 295 | Alpha-1 giardin, giardin subunit alpha-1; annexin, | 2e-22 |
| >1n00_A Annexin GH1; membrane-binding, calcium-binding, membrane protein; 2.10A {Gossypium hirsutum} SCOP: a.65.1.1 PDB: 3brx_A 1ycn_A 2q4c_A 1dk5_A Length = 321 | Back alignment and structure |
|---|
Score = 196 bits (499), Expect = 5e-62
Identities = 70/235 (29%), Positives = 117/235 (49%), Gaps = 14/235 (5%)
Query: 15 WMLGSHERDAAVARQALEESVVNFKALIEILVGRKSSHIALIKQAYQTRYKRHLDQDIAN 74
W L ERDA +A +A + + + L+EI R ++ + +QAY RYK+ L++D+A+
Sbjct: 85 WALDPAERDALLANEATKRWTSSNQVLMEIACTRSANQLLHARQAYHARYKKSLEEDVAH 144
Query: 75 IEPPHPYQKAH----------NADVSQHVAKCDAKRLYETGEGSPGAAEKAVVLEIFSKR 124
+ K +V+ +AK +AK L+E + + V+ + + R
Sbjct: 145 -HTTGDFHKLLLPLVSSYRYEGEEVNMTLAKTEAKLLHEKISNKAYSDDD--VIRVLATR 201
Query: 125 SIPQMKLTFSCYKHIYGHDYTKSLKRGNSTDFEDALKMVVKCILNPPNYYAKTLYASIKG 184
S Q+ T + YK+ YG+D K LK +F L+ VKC++ P Y+ K L +I
Sbjct: 202 SKAQINATLNHYKNEYGNDINKDLKADPKDEFLALLRSTVKCLVYPEKYFEKVLRLAINR 261
Query: 185 TRVDKAAVARVLVSRAEVDMDEIQRIFKKKYGMELRDAICESIPSGDYRDFLVAL 239
D+ A+ RV+ +RAEVD+ I ++++ + L AI GDY L+ L
Sbjct: 262 RGTDEGALTRVVCTRAEVDLKVIADEYQRRNSVPLTRAI-VKDTHGDYEKLLLVL 315
|
| >1n00_A Annexin GH1; membrane-binding, calcium-binding, membrane protein; 2.10A {Gossypium hirsutum} SCOP: a.65.1.1 PDB: 3brx_A 1ycn_A 2q4c_A 1dk5_A Length = 321 | Back alignment and structure |
|---|
| >1n00_A Annexin GH1; membrane-binding, calcium-binding, membrane protein; 2.10A {Gossypium hirsutum} SCOP: a.65.1.1 PDB: 3brx_A 1ycn_A 2q4c_A 1dk5_A Length = 321 | Back alignment and structure |
|---|
| >1n00_A Annexin GH1; membrane-binding, calcium-binding, membrane protein; 2.10A {Gossypium hirsutum} SCOP: a.65.1.1 PDB: 3brx_A 1ycn_A 2q4c_A 1dk5_A Length = 321 | Back alignment and structure |
|---|
| >1w3w_A Annexin A8; coagulation, annexin family, calcium and phospholipid binding proteins; 1.99A {Homo sapiens} PDB: 1w45_A Length = 327 | Back alignment and structure |
|---|
| >1w3w_A Annexin A8; coagulation, annexin family, calcium and phospholipid binding proteins; 1.99A {Homo sapiens} PDB: 1w45_A Length = 327 | Back alignment and structure |
|---|
| >1w3w_A Annexin A8; coagulation, annexin family, calcium and phospholipid binding proteins; 1.99A {Homo sapiens} PDB: 1w45_A Length = 327 | Back alignment and structure |
|---|
| >1w3w_A Annexin A8; coagulation, annexin family, calcium and phospholipid binding proteins; 1.99A {Homo sapiens} PDB: 1w45_A Length = 327 | Back alignment and structure |
|---|
| >1w3w_A Annexin A8; coagulation, annexin family, calcium and phospholipid binding proteins; 1.99A {Homo sapiens} PDB: 1w45_A Length = 327 | Back alignment and structure |
|---|
| >1hm6_A Annexin 1; phospholipid/Ca(2+)-binding protein, calcium-free form, FULL-length protein comprising protein core and N-terminal domain, metal; 1.80A {Sus scrofa} SCOP: a.65.1.1 PDB: 1mcx_A 1ain_A 1bo9_A Length = 346 | Back alignment and structure |
|---|
| >1hm6_A Annexin 1; phospholipid/Ca(2+)-binding protein, calcium-free form, FULL-length protein comprising protein core and N-terminal domain, metal; 1.80A {Sus scrofa} SCOP: a.65.1.1 PDB: 1mcx_A 1ain_A 1bo9_A Length = 346 | Back alignment and structure |
|---|
| >1hm6_A Annexin 1; phospholipid/Ca(2+)-binding protein, calcium-free form, FULL-length protein comprising protein core and N-terminal domain, metal; 1.80A {Sus scrofa} SCOP: a.65.1.1 PDB: 1mcx_A 1ain_A 1bo9_A Length = 346 | Back alignment and structure |
|---|
| >2hyv_A Annexin A2; calcium-binding protein, membrane-binding protein, helix BUN heparin, hexasaccharide, metal binding protein; HET: UAP SGN IDS; 1.42A {Homo sapiens} PDB: 2hyu_A* 2hyw_A 1w7b_A 1xjl_A Length = 308 | Back alignment and structure |
|---|
| >2hyv_A Annexin A2; calcium-binding protein, membrane-binding protein, helix BUN heparin, hexasaccharide, metal binding protein; HET: UAP SGN IDS; 1.42A {Homo sapiens} PDB: 2hyu_A* 2hyw_A 1w7b_A 1xjl_A Length = 308 | Back alignment and structure |
|---|
| >2hyv_A Annexin A2; calcium-binding protein, membrane-binding protein, helix BUN heparin, hexasaccharide, metal binding protein; HET: UAP SGN IDS; 1.42A {Homo sapiens} PDB: 2hyu_A* 2hyw_A 1w7b_A 1xjl_A Length = 308 | Back alignment and structure |
|---|
| >2hyv_A Annexin A2; calcium-binding protein, membrane-binding protein, helix BUN heparin, hexasaccharide, metal binding protein; HET: UAP SGN IDS; 1.42A {Homo sapiens} PDB: 2hyu_A* 2hyw_A 1w7b_A 1xjl_A Length = 308 | Back alignment and structure |
|---|
| >2hyv_A Annexin A2; calcium-binding protein, membrane-binding protein, helix BUN heparin, hexasaccharide, metal binding protein; HET: UAP SGN IDS; 1.42A {Homo sapiens} PDB: 2hyu_A* 2hyw_A 1w7b_A 1xjl_A Length = 308 | Back alignment and structure |
|---|
| >1axn_A Annexin III; annexin family, calcium/phospholipid-binding protein complex; 1.78A {Homo sapiens} SCOP: a.65.1.1 PDB: 1aii_A Length = 323 | Back alignment and structure |
|---|
| >1axn_A Annexin III; annexin family, calcium/phospholipid-binding protein complex; 1.78A {Homo sapiens} SCOP: a.65.1.1 PDB: 1aii_A Length = 323 | Back alignment and structure |
|---|
| >1axn_A Annexin III; annexin family, calcium/phospholipid-binding protein complex; 1.78A {Homo sapiens} SCOP: a.65.1.1 PDB: 1aii_A Length = 323 | Back alignment and structure |
|---|
| >1axn_A Annexin III; annexin family, calcium/phospholipid-binding protein complex; 1.78A {Homo sapiens} SCOP: a.65.1.1 PDB: 1aii_A Length = 323 | Back alignment and structure |
|---|
| >1axn_A Annexin III; annexin family, calcium/phospholipid-binding protein complex; 1.78A {Homo sapiens} SCOP: a.65.1.1 PDB: 1aii_A Length = 323 | Back alignment and structure |
|---|
| >2zhj_A Annexin A4; zynogen granule, membrane binding protein, metal binding protein, calcium, calcium/phospholipid-binding; 1.35A {Rattus norvegicus} PDB: 2zhi_A 2zoc_A 1ann_A 1i4a_A 1aow_A Length = 322 | Back alignment and structure |
|---|
| >2zhj_A Annexin A4; zynogen granule, membrane binding protein, metal binding protein, calcium, calcium/phospholipid-binding; 1.35A {Rattus norvegicus} PDB: 2zhi_A 2zoc_A 1ann_A 1i4a_A 1aow_A Length = 322 | Back alignment and structure |
|---|
| >2zhj_A Annexin A4; zynogen granule, membrane binding protein, metal binding protein, calcium, calcium/phospholipid-binding; 1.35A {Rattus norvegicus} PDB: 2zhi_A 2zoc_A 1ann_A 1i4a_A 1aow_A Length = 322 | Back alignment and structure |
|---|
| >2zhj_A Annexin A4; zynogen granule, membrane binding protein, metal binding protein, calcium, calcium/phospholipid-binding; 1.35A {Rattus norvegicus} PDB: 2zhi_A 2zoc_A 1ann_A 1i4a_A 1aow_A Length = 322 | Back alignment and structure |
|---|
| >2zhj_A Annexin A4; zynogen granule, membrane binding protein, metal binding protein, calcium, calcium/phospholipid-binding; 1.35A {Rattus norvegicus} PDB: 2zhi_A 2zoc_A 1ann_A 1i4a_A 1aow_A Length = 322 | Back alignment and structure |
|---|
| >1yii_A Annexin A5, annexin V, lipocortin V, endonexin II; membrane binding, matrix vessicle, protein and metal binding protein; 1.42A {Gallus gallus} PDB: 1yj0_A 1ala_A 1hvd_A 1anx_A 1anw_A 1avh_A 1avr_A 1hak_B* 1hvf_A 1hve_A 1hvg_A 1a8a_A* 1a8b_A* 2ie7_A 1g5n_A 2ie6_A 1bcz_A 1n41_A 1bcw_A 2ran_A ... Length = 320 | Back alignment and structure |
|---|
| >1yii_A Annexin A5, annexin V, lipocortin V, endonexin II; membrane binding, matrix vessicle, protein and metal binding protein; 1.42A {Gallus gallus} PDB: 1yj0_A 1ala_A 1hvd_A 1anx_A 1anw_A 1avh_A 1avr_A 1hak_B* 1hvf_A 1hve_A 1hvg_A 1a8a_A* 1a8b_A* 2ie7_A 1g5n_A 2ie6_A 1bcz_A 1n41_A 1bcw_A 2ran_A ... Length = 320 | Back alignment and structure |
|---|
| >1yii_A Annexin A5, annexin V, lipocortin V, endonexin II; membrane binding, matrix vessicle, protein and metal binding protein; 1.42A {Gallus gallus} PDB: 1yj0_A 1ala_A 1hvd_A 1anx_A 1anw_A 1avh_A 1avr_A 1hak_B* 1hvf_A 1hve_A 1hvg_A 1a8a_A* 1a8b_A* 2ie7_A 1g5n_A 2ie6_A 1bcz_A 1n41_A 1bcw_A 2ran_A ... Length = 320 | Back alignment and structure |
|---|
| >1yii_A Annexin A5, annexin V, lipocortin V, endonexin II; membrane binding, matrix vessicle, protein and metal binding protein; 1.42A {Gallus gallus} PDB: 1yj0_A 1ala_A 1hvd_A 1anx_A 1anw_A 1avh_A 1avr_A 1hak_B* 1hvf_A 1hve_A 1hvg_A 1a8a_A* 1a8b_A* 2ie7_A 1g5n_A 2ie6_A 1bcz_A 1n41_A 1bcw_A 2ran_A ... Length = 320 | Back alignment and structure |
|---|
| >1yii_A Annexin A5, annexin V, lipocortin V, endonexin II; membrane binding, matrix vessicle, protein and metal binding protein; 1.42A {Gallus gallus} PDB: 1yj0_A 1ala_A 1hvd_A 1anx_A 1anw_A 1avh_A 1avr_A 1hak_B* 1hvf_A 1hve_A 1hvg_A 1a8a_A* 1a8b_A* 2ie7_A 1g5n_A 2ie6_A 1bcz_A 1n41_A 1bcw_A 2ran_A ... Length = 320 | Back alignment and structure |
|---|
| >1dm5_A Annexin XII E105K mutant homohexamer; novel PH-dependent hexamerization switch E76, low calcium form; 1.93A {Hydra vulgaris} SCOP: a.65.1.1 PDB: 1aei_A Length = 315 | Back alignment and structure |
|---|
| >1dm5_A Annexin XII E105K mutant homohexamer; novel PH-dependent hexamerization switch E76, low calcium form; 1.93A {Hydra vulgaris} SCOP: a.65.1.1 PDB: 1aei_A Length = 315 | Back alignment and structure |
|---|
| >1dm5_A Annexin XII E105K mutant homohexamer; novel PH-dependent hexamerization switch E76, low calcium form; 1.93A {Hydra vulgaris} SCOP: a.65.1.1 PDB: 1aei_A Length = 315 | Back alignment and structure |
|---|
| >1dm5_A Annexin XII E105K mutant homohexamer; novel PH-dependent hexamerization switch E76, low calcium form; 1.93A {Hydra vulgaris} SCOP: a.65.1.1 PDB: 1aei_A Length = 315 | Back alignment and structure |
|---|
| >1dm5_A Annexin XII E105K mutant homohexamer; novel PH-dependent hexamerization switch E76, low calcium form; 1.93A {Hydra vulgaris} SCOP: a.65.1.1 PDB: 1aei_A Length = 315 | Back alignment and structure |
|---|
| >1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 | Back alignment and structure |
|---|
| >1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 | Back alignment and structure |
|---|
| >1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 | Back alignment and structure |
|---|
| >1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 | Back alignment and structure |
|---|
| >1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 | Back alignment and structure |
|---|
| >1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 | Back alignment and structure |
|---|
| >1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 | Back alignment and structure |
|---|
| >1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 | Back alignment and structure |
|---|
| >2ii2_A Alpha-11 giardin; helix-turn-helix, metal binding protein; 1.10A {Giardia intestinalis} PDB: 2iic_A Length = 310 | Back alignment and structure |
|---|
| >2ii2_A Alpha-11 giardin; helix-turn-helix, metal binding protein; 1.10A {Giardia intestinalis} PDB: 2iic_A Length = 310 | Back alignment and structure |
|---|
| >2ii2_A Alpha-11 giardin; helix-turn-helix, metal binding protein; 1.10A {Giardia intestinalis} PDB: 2iic_A Length = 310 | Back alignment and structure |
|---|
| >3chj_A Alpha-14 giardin; calcium-binding, annexin, metal binding protein; 1.60A {Giardia lamblia} PDB: 3chk_A 3chl_A Length = 337 | Back alignment and structure |
|---|
| >3chj_A Alpha-14 giardin; calcium-binding, annexin, metal binding protein; 1.60A {Giardia lamblia} PDB: 3chk_A 3chl_A Length = 337 | Back alignment and structure |
|---|
| >3chj_A Alpha-14 giardin; calcium-binding, annexin, metal binding protein; 1.60A {Giardia lamblia} PDB: 3chk_A 3chl_A Length = 337 | Back alignment and structure |
|---|
| >3chj_A Alpha-14 giardin; calcium-binding, annexin, metal binding protein; 1.60A {Giardia lamblia} PDB: 3chk_A 3chl_A Length = 337 | Back alignment and structure |
|---|
| >4evf_A Alpha-1 giardin, giardin subunit alpha-1; annexin, calcium-binding protein, membrane-binding protein, binding protein; 1.90A {Giardia intestinalis} PDB: 4evh_A Length = 295 | Back alignment and structure |
|---|
| >4evf_A Alpha-1 giardin, giardin subunit alpha-1; annexin, calcium-binding protein, membrane-binding protein, binding protein; 1.90A {Giardia intestinalis} PDB: 4evh_A Length = 295 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 246 | |||
| 2hyv_A | 308 | Annexin A2; calcium-binding protein, membrane-bind | 100.0 | |
| 1hm6_A | 346 | Annexin 1; phospholipid/Ca(2+)-binding protein, ca | 100.0 | |
| 1axn_A | 323 | Annexin III; annexin family, calcium/phospholipid- | 100.0 | |
| 2zhj_A | 322 | Annexin A4; zynogen granule, membrane binding prot | 100.0 | |
| 1dm5_A | 315 | Annexin XII E105K mutant homohexamer; novel PH-dep | 100.0 | |
| 1yii_A | 320 | Annexin A5, annexin V, lipocortin V, endonexin II; | 100.0 | |
| 1w3w_A | 327 | Annexin A8; coagulation, annexin family, calcium a | 100.0 | |
| 1n00_A | 321 | Annexin GH1; membrane-binding, calcium-binding, me | 100.0 | |
| 1m9i_A | 672 | Annexin VI; calcium-binding, membrane-binding, pho | 100.0 | |
| 3chj_A | 337 | Alpha-14 giardin; calcium-binding, annexin, metal | 100.0 | |
| 1n00_A | 321 | Annexin GH1; membrane-binding, calcium-binding, me | 100.0 | |
| 1m9i_A | 672 | Annexin VI; calcium-binding, membrane-binding, pho | 100.0 | |
| 2ii2_A | 310 | Alpha-11 giardin; helix-turn-helix, metal binding | 100.0 | |
| 1yii_A | 320 | Annexin A5, annexin V, lipocortin V, endonexin II; | 100.0 | |
| 1dm5_A | 315 | Annexin XII E105K mutant homohexamer; novel PH-dep | 100.0 | |
| 2zhj_A | 322 | Annexin A4; zynogen granule, membrane binding prot | 100.0 | |
| 1w3w_A | 327 | Annexin A8; coagulation, annexin family, calcium a | 100.0 | |
| 1axn_A | 323 | Annexin III; annexin family, calcium/phospholipid- | 100.0 | |
| 2hyv_A | 308 | Annexin A2; calcium-binding protein, membrane-bind | 100.0 | |
| 4evf_A | 295 | Alpha-1 giardin, giardin subunit alpha-1; annexin, | 100.0 | |
| 1hm6_A | 346 | Annexin 1; phospholipid/Ca(2+)-binding protein, ca | 100.0 | |
| 4evf_A | 295 | Alpha-1 giardin, giardin subunit alpha-1; annexin, | 100.0 | |
| 2ii2_A | 310 | Alpha-11 giardin; helix-turn-helix, metal binding | 100.0 | |
| 3chj_A | 337 | Alpha-14 giardin; calcium-binding, annexin, metal | 100.0 |
| >2hyv_A Annexin A2; calcium-binding protein, membrane-binding protein, helix BUN heparin, hexasaccharide, metal binding protein; HET: UAP SGN IDS; 1.42A {Homo sapiens} PDB: 2hyu_A* 2hyw_A 1w7b_A 1xjl_A | Back alignment and structure |
|---|
Probab=100.00 E-value=1.2e-62 Score=428.85 Aligned_cols=237 Identities=28% Similarity=0.460 Sum_probs=227.9
Q ss_pred ChhhHHHHHHHHcCCChHHHHHHHHHHHhcCCCCHHHHHHHHhCCCHHHHHHHHHHHHHhhccCHHHHhhccCCCCcccc
Q 025907 4 FLPKNCAALDVWMLGSHERDAAVARQALEESVVNFKALIEILVGRKSSHIALIKQAYQTRYKRHLDQDIANIEPPHPYQK 83 (246)
Q Consensus 4 ~~~~~~~~l~~l~~~~~~~da~~L~~A~~g~g~de~~li~iL~~rs~~e~~~I~~~Y~~~~~~~L~~~i~~~~~~g~~~~ 83 (246)
++|+|++++++|+++|+++||+.|++||+|.|||+.+||+|||+|||.|+++|+++|+.+||++|+++|+ +++||+|++
T Consensus 60 lsG~fe~~l~~l~~~~~~~DA~~L~~AmkG~Gtde~~LieIL~~Rs~~q~~~Ik~aY~~~y~~~L~~di~-se~sG~f~~ 138 (308)
T 2hyv_A 60 LSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDII-SDTSGDFRK 138 (308)
T ss_dssp CCHHHHHHHHHHHSCHHHHHHHHHHHHTSTTCCCHHHHHHHHHHCCHHHHHHHHHHHHHHHSSCHHHHHH-HTCCHHHHH
T ss_pred cCCCHHHHHHHHcCCcHHHHHHHHHHHhhcCCCCHHHHHHHHhcCCHHHHHHHHHHHHHhhCCCHHHHHh-hccCccHHH
Confidence 5799999999999999999999999999999999999999999999999999999999999999999999 999999998
Q ss_pred cc-----------ccccchhHHHHHHHHHHhhcCCCCCCChHHHHHHHhhcCCHHHHHHHHHHHHHHhCCCHHHHHhhcC
Q 025907 84 AH-----------NADVSQHVAKCDAKRLYETGEGSPGAAEKAVVLEIFSKRSIPQMKLTFSCYKHIYGHDYTKSLKRGN 152 (246)
Q Consensus 84 ~~-----------~~~~~~~~~~~da~~L~~A~~g~~g~td~~~li~Il~~rs~~~l~~I~~~Y~~~~g~~L~~~I~~~~ 152 (246)
.+ ..+++.++++.||..|++|+++++| ||++++|+|||+||++||++|+++|+..||++|+++|++++
T Consensus 139 ll~~l~~~~r~~e~~~vd~~~a~~DA~~L~~A~~~~~G-tde~~li~Il~~RS~~~L~~i~~~Y~~~~g~~Le~~I~~e~ 217 (308)
T 2hyv_A 139 LMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKG-TDVPKWISIMTERSVPHLQKVFDRYKSYSPYDMLESIRKEV 217 (308)
T ss_dssp HHHHHHTCCCCCCCSSCCHHHHHHHHHHHHHTTTTSSS-CCHHHHHHHHHHSCHHHHHHHHHHHTTTCSSCHHHHHHHHC
T ss_pred HHHHHHccccccccCCCCccHHHHHHHHHHHHhhccCC-CcHHHHHHHHHhCCHHHHHHHHHHHHHHHCcCHHHHHHHhc
Confidence 32 1235678999999999999988887 99999999999999999999999999999999999999999
Q ss_pred CCchHHHHHHHHHhhCCchHHHHHHHHHhhcCCCCCHHHHHHHHHhCCHHHHHHHHHHHHHhhCccHHHHhhccCCChHH
Q 025907 153 STDFEDALKMVVKCILNPPNYYAKTLYASIKGTRVDKAAVARVLVSRAEVDMDEIQRIFKKKYGMELRDAICESIPSGDY 232 (246)
Q Consensus 153 ~g~~~~~l~~~~~~~~~~~~~~A~~L~~a~~g~gtd~~~li~il~~rs~~~l~~i~~~Y~~~yg~~L~~~I~~~~~~G~~ 232 (246)
||+|+++|+++++|.++|+.++|+.||+||+|.|||+..||||+++||+.||..|+.+|++.||++|.++|+++ +||||
T Consensus 218 sG~~~~~L~~lv~~~~~~~~~~A~~L~~A~~g~GTde~~lirilv~Rs~~~l~~I~~~Y~~~yg~~L~~~I~~e-~sGdy 296 (308)
T 2hyv_A 218 KGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKGTRDKVLIRIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQD-TKGDY 296 (308)
T ss_dssp CHHHHHHHHHHHHHHHCHHHHHHHHHHHHHSSSSCCHHHHHHHHHHHTTTTHHHHHHHHHHHHSSCHHHHHHHH-CCHHH
T ss_pred CchHHHHHHHHHhccCCCcHHHHHHHHHHhccCCCCHHHHHHHHHhcCHHHHHHHHHHHHHHhCCcHHHHHHhh-CChHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999 79999
Q ss_pred HHHHHHHhccc
Q 025907 233 RDFLVALATKA 243 (246)
Q Consensus 233 ~~~Ll~l~~~~ 243 (246)
+++|++||++.
T Consensus 297 ~~~Llal~~~~ 307 (308)
T 2hyv_A 297 QKALLYLCGGD 307 (308)
T ss_dssp HHHHHHHHTSC
T ss_pred HHHHHHHhCCC
Confidence 99999999864
|
| >1hm6_A Annexin 1; phospholipid/Ca(2+)-binding protein, calcium-free form, FULL-length protein comprising protein core and N-terminal domain, metal; 1.80A {Sus scrofa} SCOP: a.65.1.1 PDB: 1mcx_A 1ain_A 1bo9_A | Back alignment and structure |
|---|
| >1axn_A Annexin III; annexin family, calcium/phospholipid-binding protein complex; 1.78A {Homo sapiens} SCOP: a.65.1.1 PDB: 1aii_A | Back alignment and structure |
|---|
| >2zhj_A Annexin A4; zynogen granule, membrane binding protein, metal binding protein, calcium, calcium/phospholipid-binding; 1.35A {Rattus norvegicus} PDB: 2zhi_A 2zoc_A 1ann_A 1i4a_A 1aow_A | Back alignment and structure |
|---|
| >1dm5_A Annexin XII E105K mutant homohexamer; novel PH-dependent hexamerization switch E76, low calcium form; 1.93A {Hydra vulgaris} SCOP: a.65.1.1 PDB: 1aei_A | Back alignment and structure |
|---|
| >1yii_A Annexin A5, annexin V, lipocortin V, endonexin II; membrane binding, matrix vessicle, protein and metal binding protein; 1.42A {Gallus gallus} PDB: 1yj0_A 1ala_A 1hvd_A 1anx_A 1anw_A 1avh_A 1avr_A 1hak_B* 1hvf_A 1hve_A 1hvg_A 1a8a_A* 1a8b_A* 2ie7_A 1g5n_A 2ie6_A 1bcz_A 1n41_A 1bcw_A 2ran_A ... | Back alignment and structure |
|---|
| >1w3w_A Annexin A8; coagulation, annexin family, calcium and phospholipid binding proteins; 1.99A {Homo sapiens} PDB: 1w45_A | Back alignment and structure |
|---|
| >1n00_A Annexin GH1; membrane-binding, calcium-binding, membrane protein; 2.10A {Gossypium hirsutum} SCOP: a.65.1.1 PDB: 3brx_A 1ycn_A 2q4c_A 1dk5_A | Back alignment and structure |
|---|
| >1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A | Back alignment and structure |
|---|
| >3chj_A Alpha-14 giardin; calcium-binding, annexin, metal binding protein; 1.60A {Giardia lamblia} PDB: 3chk_A 3chl_A | Back alignment and structure |
|---|
| >1n00_A Annexin GH1; membrane-binding, calcium-binding, membrane protein; 2.10A {Gossypium hirsutum} SCOP: a.65.1.1 PDB: 3brx_A 1ycn_A 2q4c_A 1dk5_A | Back alignment and structure |
|---|
| >1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A | Back alignment and structure |
|---|
| >2ii2_A Alpha-11 giardin; helix-turn-helix, metal binding protein; 1.10A {Giardia intestinalis} PDB: 2iic_A | Back alignment and structure |
|---|
| >1yii_A Annexin A5, annexin V, lipocortin V, endonexin II; membrane binding, matrix vessicle, protein and metal binding protein; 1.42A {Gallus gallus} PDB: 1yj0_A 1ala_A 1hvd_A 1anx_A 1anw_A 1avh_A 1avr_A 1hak_B* 1hvf_A 1hve_A 1hvg_A 1a8a_A* 1a8b_A* 2ie7_A 1g5n_A 2ie6_A 1bcz_A 1n41_A 1bcw_A 2ran_A ... | Back alignment and structure |
|---|
| >1dm5_A Annexin XII E105K mutant homohexamer; novel PH-dependent hexamerization switch E76, low calcium form; 1.93A {Hydra vulgaris} SCOP: a.65.1.1 PDB: 1aei_A | Back alignment and structure |
|---|
| >2zhj_A Annexin A4; zynogen granule, membrane binding protein, metal binding protein, calcium, calcium/phospholipid-binding; 1.35A {Rattus norvegicus} PDB: 2zhi_A 2zoc_A 1ann_A 1i4a_A 1aow_A | Back alignment and structure |
|---|
| >1w3w_A Annexin A8; coagulation, annexin family, calcium and phospholipid binding proteins; 1.99A {Homo sapiens} PDB: 1w45_A | Back alignment and structure |
|---|
| >1axn_A Annexin III; annexin family, calcium/phospholipid-binding protein complex; 1.78A {Homo sapiens} SCOP: a.65.1.1 PDB: 1aii_A | Back alignment and structure |
|---|
| >2hyv_A Annexin A2; calcium-binding protein, membrane-binding protein, helix BUN heparin, hexasaccharide, metal binding protein; HET: UAP SGN IDS; 1.42A {Homo sapiens} PDB: 2hyu_A* 2hyw_A 1w7b_A 1xjl_A | Back alignment and structure |
|---|
| >4evf_A Alpha-1 giardin, giardin subunit alpha-1; annexin, calcium-binding protein, membrane-binding protein, binding protein; 1.90A {Giardia intestinalis} PDB: 4evh_A | Back alignment and structure |
|---|
| >1hm6_A Annexin 1; phospholipid/Ca(2+)-binding protein, calcium-free form, FULL-length protein comprising protein core and N-terminal domain, metal; 1.80A {Sus scrofa} SCOP: a.65.1.1 PDB: 1mcx_A 1ain_A 1bo9_A | Back alignment and structure |
|---|
| >4evf_A Alpha-1 giardin, giardin subunit alpha-1; annexin, calcium-binding protein, membrane-binding protein, binding protein; 1.90A {Giardia intestinalis} PDB: 4evh_A | Back alignment and structure |
|---|
| >2ii2_A Alpha-11 giardin; helix-turn-helix, metal binding protein; 1.10A {Giardia intestinalis} PDB: 2iic_A | Back alignment and structure |
|---|
| >3chj_A Alpha-14 giardin; calcium-binding, annexin, metal binding protein; 1.60A {Giardia lamblia} PDB: 3chk_A 3chl_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 246 | ||||
| d1w7ba_ | 319 | a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [Ta | 3e-53 | |
| d1w7ba_ | 319 | a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [Ta | 1e-16 | |
| d1axna_ | 323 | a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [T | 6e-53 | |
| d1axna_ | 323 | a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [T | 1e-14 | |
| d2ie7a1 | 318 | a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegic | 9e-53 | |
| d2ie7a1 | 318 | a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegic | 6e-16 | |
| d2ie7a1 | 318 | a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegic | 6e-08 | |
| d1avca1 | 341 | a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [ | 2e-52 | |
| d1avca1 | 341 | a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [ | 6e-13 | |
| d1hm6a_ | 343 | a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: | 3e-52 | |
| d1hm6a_ | 343 | a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: | 2e-16 | |
| d1i4aa_ | 309 | a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: | 3e-51 | |
| d1i4aa_ | 309 | a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: | 2e-16 | |
| d1i4aa_ | 309 | a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: | 2e-07 | |
| d1dm5a_ | 315 | a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: | 4e-51 | |
| d1dm5a_ | 315 | a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: | 2e-15 | |
| d1dm5a_ | 315 | a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: | 6e-08 | |
| d1n00a_ | 318 | a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsu | 1e-50 | |
| d1n00a_ | 318 | a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsu | 1e-16 | |
| d1avca2 | 321 | a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) | 6e-49 | |
| d1avca2 | 321 | a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) | 8e-15 | |
| d1avca2 | 321 | a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) | 2e-05 | |
| d1bo9a_ | 73 | a.65.1.1 (A:) Annexin I {Human (Homo sapiens) [Tax | 4e-13 | |
| d1bo9a_ | 73 | a.65.1.1 (A:) Annexin I {Human (Homo sapiens) [Tax | 4e-11 | |
| d1bo9a_ | 73 | a.65.1.1 (A:) Annexin I {Human (Homo sapiens) [Tax | 5e-08 |
| >d1w7ba_ a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [TaxId: 9606]} Length = 319 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Annexin superfamily: Annexin family: Annexin domain: Annexin II species: Human (Homo sapiens) [TaxId: 9606]
Score = 172 bits (437), Expect = 3e-53
Identities = 65/241 (26%), Positives = 116/241 (48%), Gaps = 12/241 (4%)
Query: 9 CAALDVWMLGSHERDAAVARQALEESVVNFKALIEILVGRKSSHIALIKQAYQTRYKRHL 68
+ + + DA+ + +++ + +LIEI+ R + + I + Y+ YK L
Sbjct: 76 ETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDL 135
Query: 69 DQDIAN----------IEPPHPYQKAHNADVSQHVAKCDAKRLYETGEGSPGAAEKAVVL 118
++DI + + + + + + DA+ LY+ G G +
Sbjct: 136 EKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWI- 194
Query: 119 EIFSKRSIPQMKLTFSCYKHIYGHDYTKSLKRGNSTDFEDALKMVVKCILNPPNYYAKTL 178
I ++RS+P ++ F YK +D +S+++ D E+A +V+CI N P Y+A L
Sbjct: 195 SIMTERSVPHLQKVFDRYKSYSPYDMLESIRKEVKGDLENAFLNLVQCIQNKPLYFADRL 254
Query: 179 YASIKGTRVDKAAVARVLVSRAEVDMDEIQRIFKKKYGMELRDAICESIPSGDYRDFLVA 238
Y S+KG + R++VSR+EVDM +I+ FK+KYG L I + GDY+ L+
Sbjct: 255 YDSMKGKGTRDKVLIRIMVSRSEVDMLKIRSEFKRKYGKSLYYYI-QQDTKGDYQKALLY 313
Query: 239 L 239
L
Sbjct: 314 L 314
|
| >d1w7ba_ a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [TaxId: 9606]} Length = 319 | Back information, alignment and structure |
|---|
| >d1axna_ a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [TaxId: 9606]} Length = 323 | Back information, alignment and structure |
|---|
| >d1axna_ a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [TaxId: 9606]} Length = 323 | Back information, alignment and structure |
|---|
| >d2ie7a1 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 318 | Back information, alignment and structure |
|---|
| >d2ie7a1 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 318 | Back information, alignment and structure |
|---|
| >d2ie7a1 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 318 | Back information, alignment and structure |
|---|
| >d1avca1 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 341 | Back information, alignment and structure |
|---|
| >d1avca1 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 341 | Back information, alignment and structure |
|---|
| >d1hm6a_ a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 9823]} Length = 343 | Back information, alignment and structure |
|---|
| >d1hm6a_ a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 9823]} Length = 343 | Back information, alignment and structure |
|---|
| >d1i4aa_ a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 9913]} Length = 309 | Back information, alignment and structure |
|---|
| >d1i4aa_ a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 9913]} Length = 309 | Back information, alignment and structure |
|---|
| >d1i4aa_ a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 9913]} Length = 309 | Back information, alignment and structure |
|---|
| >d1dm5a_ a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 6087]} Length = 315 | Back information, alignment and structure |
|---|
| >d1dm5a_ a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 6087]} Length = 315 | Back information, alignment and structure |
|---|
| >d1dm5a_ a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 6087]} Length = 315 | Back information, alignment and structure |
|---|
| >d1n00a_ a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3635]} Length = 318 | Back information, alignment and structure |
|---|
| >d1n00a_ a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3635]} Length = 318 | Back information, alignment and structure |
|---|
| >d1avca2 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 321 | Back information, alignment and structure |
|---|
| >d1avca2 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 321 | Back information, alignment and structure |
|---|
| >d1avca2 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 321 | Back information, alignment and structure |
|---|
| >d1bo9a_ a.65.1.1 (A:) Annexin I {Human (Homo sapiens) [TaxId: 9606]} Length = 73 | Back information, alignment and structure |
|---|
| >d1bo9a_ a.65.1.1 (A:) Annexin I {Human (Homo sapiens) [TaxId: 9606]} Length = 73 | Back information, alignment and structure |
|---|
| >d1bo9a_ a.65.1.1 (A:) Annexin I {Human (Homo sapiens) [TaxId: 9606]} Length = 73 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 246 | |||
| d1avca1 | 341 | Annexin VI {Cow (Bos taurus) [TaxId: 9913]} | 100.0 | |
| d1i4aa_ | 309 | Annexin IV {Cow (Bos taurus) [TaxId: 9913]} | 100.0 | |
| d1axna_ | 323 | Annexin III {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1w7ba_ | 319 | Annexin II {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1hm6a_ | 343 | Annexin I {Pig (Sus scrofa) [TaxId: 9823]} | 100.0 | |
| d1dm5a_ | 315 | Annexin XII {Hydra vulgaris [TaxId: 6087]} | 100.0 | |
| d2ie7a1 | 318 | Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} | 100.0 | |
| d1n00a_ | 318 | Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3 | 100.0 | |
| d1avca2 | 321 | Annexin VI {Cow (Bos taurus) [TaxId: 9913]} | 100.0 | |
| d1w7ba_ | 319 | Annexin II {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1avca1 | 341 | Annexin VI {Cow (Bos taurus) [TaxId: 9913]} | 100.0 | |
| d1axna_ | 323 | Annexin III {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1i4aa_ | 309 | Annexin IV {Cow (Bos taurus) [TaxId: 9913]} | 100.0 | |
| d1n00a_ | 318 | Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3 | 100.0 | |
| d1dm5a_ | 315 | Annexin XII {Hydra vulgaris [TaxId: 6087]} | 100.0 | |
| d1hm6a_ | 343 | Annexin I {Pig (Sus scrofa) [TaxId: 9823]} | 100.0 | |
| d2ie7a1 | 318 | Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} | 100.0 | |
| d1avca2 | 321 | Annexin VI {Cow (Bos taurus) [TaxId: 9913]} | 100.0 | |
| d1bo9a_ | 73 | Annexin I {Human (Homo sapiens) [TaxId: 9606]} | 99.79 | |
| d1bo9a_ | 73 | Annexin I {Human (Homo sapiens) [TaxId: 9606]} | 99.72 |
| >d1avca1 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Annexin superfamily: Annexin family: Annexin domain: Annexin VI species: Cow (Bos taurus) [TaxId: 9913]
Probab=100.00 E-value=1.2e-59 Score=412.11 Aligned_cols=237 Identities=30% Similarity=0.461 Sum_probs=228.1
Q ss_pred ChhhHHHHHHHHcCCChHHHHHHHHHHHhcCCCCHHHHHHHHhCCCHHHHHHHHHHHHHhhccCHHHHhhccCCCCcccc
Q 025907 4 FLPKNCAALDVWMLGSHERDAAVARQALEESVVNFKALIEILVGRKSSHIALIKQAYQTRYKRHLDQDIANIEPPHPYQK 83 (246)
Q Consensus 4 ~~~~~~~~l~~l~~~~~~~da~~L~~A~~g~g~de~~li~iL~~rs~~e~~~I~~~Y~~~~~~~L~~~i~~~~~~g~~~~ 83 (246)
++|+|++++++|+.+|+++||..|++||+|.|||+.+|++|||+|||.|+.+|+++|+..|+++|+++|. +++||+|++
T Consensus 69 lsG~f~~~l~~l~~~p~~~dA~~l~~A~kG~gtde~~LieIL~trs~~ei~~ik~aY~~~y~~~L~~dI~-~e~sg~~~~ 147 (341)
T d1avca1 69 LTGKFERLIVGLMRPPAYADAKEIKDAISGIGTDEKCLIEILASRTNEQIHQLVAAYKDAYERDLEADIT-GDTSGHFRK 147 (341)
T ss_dssp CCSHHHHHHHHHHSCHHHHHHHHHHHHHSSSSCCHHHHHHHHHHSCHHHHHHHHHHHHHHHCCCHHHHHH-TTCCTHHHH
T ss_pred cCchHHHHHHHHhcCHHHHHHHHHHHHHhCCCcchhhhhhhhhcCCHHHHHHHHHHHHHhcCCcHHHHHh-hcccHHHHH
Confidence 5789999999999999999999999999999999999999999999999999999999999999999999 999999988
Q ss_pred cc----------ccccchhHHHHHHHHHHhhcCCCCCCChHHHHHHHhhcCCHHHHHHHHHHHHHHhCCCHHHHHhhcCC
Q 025907 84 AH----------NADVSQHVAKCDAKRLYETGEGSPGAAEKAVVLEIFSKRSIPQMKLTFSCYKHIYGHDYTKSLKRGNS 153 (246)
Q Consensus 84 ~~----------~~~~~~~~~~~da~~L~~A~~g~~g~td~~~li~Il~~rs~~~l~~I~~~Y~~~~g~~L~~~I~~~~~ 153 (246)
.. ...++...++.||..|++|++++|| +|++.+++||++||++||++|+++|+..||++|.+.|+++++
T Consensus 148 ll~~ll~~~R~e~~~vd~~~a~~DA~~L~~A~~~k~g-tde~~~i~IL~~rs~~hL~~i~~~Y~~~~g~~l~~~i~~e~s 226 (341)
T d1avca1 148 MLVVLLQGTREEDDVVSEDLVQQDVQDLYEAGELKWG-TDEAQFIYILGNRSKQHLRLVFDEYLKTTGKPIEASIRGELS 226 (341)
T ss_dssp HHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHTTTSSS-CCHHHHHHHHHHSCHHHHHHHHHHHHHHHSSCHHHHHTTSSC
T ss_pred HHHHHHhcCCCCCCCCCHHHhHHHHHHHHHHhhccCC-CchhhheecccCCCHHHHHHHHHHHHHhcCCCHHHHHHHhcC
Confidence 21 2346888999999999999999998 899999999999999999999999999999999999999999
Q ss_pred CchHHHHHHHHHhhCCchHHHHHHHHHhhcCCCCCHHHHHHHHHhCCHHHHHHHHHHHHHhhCccHHHHhhccCCChHHH
Q 025907 154 TDFEDALKMVVKCILNPPNYYAKTLYASIKGTRVDKAAVARVLVSRAEVDMDEIQRIFKKKYGMELRDAICESIPSGDYR 233 (246)
Q Consensus 154 g~~~~~l~~~~~~~~~~~~~~A~~L~~a~~g~gtd~~~li~il~~rs~~~l~~i~~~Y~~~yg~~L~~~I~~~~~~G~~~ 233 (246)
|+++++|++++.+.+||+.++|+.|+.||+|.|||+..||||+|+|++.+|..|+.+|+++||++|.++|+++ |||+|+
T Consensus 227 G~~~~al~~iv~~~~~p~~~~A~~L~~Am~G~Gt~d~~LiriivsRse~dl~~Ik~~Y~~~ygksL~~~I~~e-tsGdy~ 305 (341)
T d1avca1 227 GDFEKLMLAVVKCIRSTAEYFAERLFKAMKGLGTRDNTLIRIMVSRSELDMLDIREIFRTKYEKSLYSMIKND-TSGEYK 305 (341)
T ss_dssp HHHHHHHHHHHHHHHCHHHHHHHHHHHHHSSSSCCHHHHHHHHHHTTTTTHHHHHHHHHHHSSSCHHHHHHHH-CCHHHH
T ss_pred CcHHHHHHHHHHHhcChHHHHHHHHHHHhcCcCcchHhHHHHhhcccHhhHHHHHHHHHHHhCCcHHHHHhhh-CChHHH
Confidence 9999999999999999999999999999999999999999999999999999999999999999999999999 899999
Q ss_pred HHHHHHhccc
Q 025907 234 DFLVALATKA 243 (246)
Q Consensus 234 ~~Ll~l~~~~ 243 (246)
++|++||++.
T Consensus 306 ~~LlaL~~~~ 315 (341)
T d1avca1 306 KTLLKLCGGD 315 (341)
T ss_dssp HHHHHHHCC-
T ss_pred HHHHHHhCCC
Confidence 9999999886
|
| >d1i4aa_ a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1axna_ a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w7ba_ a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hm6a_ a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1dm5a_ a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 6087]} | Back information, alignment and structure |
|---|
| >d2ie7a1 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1n00a_ a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3635]} | Back information, alignment and structure |
|---|
| >d1avca2 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1w7ba_ a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1avca1 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1axna_ a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i4aa_ a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1n00a_ a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3635]} | Back information, alignment and structure |
|---|
| >d1dm5a_ a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 6087]} | Back information, alignment and structure |
|---|
| >d1hm6a_ a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2ie7a1 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1avca2 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1bo9a_ a.65.1.1 (A:) Annexin I {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bo9a_ a.65.1.1 (A:) Annexin I {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|