Citrus Sinensis ID: 025969

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-----

MASLTSVAFTSIGQTSCQRKVNVSSTRSLVSNFEGFRFRTSLFCHCVRFRASSSSSRMIIQCMSTATDVPPTVAETKMNFLKLYKRPIPSIYNTVLQELIVQQHLMRYKRTYQYDPVFALGFVTVYDRLMEGYPSEEDREAIFQAYITALKEDPEQYRIDAQKLEEWARGQTASSLVEFPSKEGEVEGLLKDIAERASGKGNFSYSRFFAVGLFRLLELANATEPTVLEKVISIRSLNWMTRTSI

ccccccccccccccccccccccccccccccccccccEEEcccccEEEEEcccccccHHHHHHHHccccccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccHHHHHHccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHccccccccccc

********FTSI*********************EGFRFRTSLFCHCVRFRASSSSSRMIIQCMSTATDVPPTVAETKMNFLKLYKRPIPSIYNTVLQELIVQQHLMRYKRTYQYDPVFALGFVTVYDRLMEGYPSEEDREAIFQAYITALKEDPEQYRIDAQKL*EW*********************LLKDIAERASGKGNFSYSRFFAVGLFRLLELANATEPTVLEKVISIRSLNWM*****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein THYLAKOID FORMATION1, chloroplastic	Involved in a dynamic process of vesicle-mediated thylakoid membrane biogenesis. Required for the normal organization of vesicles into mature thylakoid stacks and ultimately for leaf development.	probable	Q84PB7
Protein THYLAKOID FORMATION 1, chloroplastic	Involved in a dynamic process of vesicle-mediated thylakoid membrane biogenesis. Required for the normal organization of vesicles into mature thylakoid stacks and ultimately for leaf development. Also involved in a sugar-signaling mechanism in roots by mediating signaling between the plasma membrane and the plastid. Probably acts downstream of the plasma membrane-delimited heterotrimeric G-protein GPA1 in a D-glucose signaling pathway.	probable	Q9SKT0

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted