Citrus Sinensis ID: 025977


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-----
MASLQHSPSSSIHQTSFLNSLPQLGVQKYGGVLPAVCRRGISLIVKAEHASMASSANSLDKCGRRQMIAVGVIAPWVSLVNQTPPSFAAESNKGFLSVTDKKDGYSFVYPFGWQEVIIEGQDKVFKDVIEPLESVSVNLIPTGKQDIRDFGPPQEVAETLIKKFLAPPTQKTKIIAASENDVDGKAYYAFEFTAQAPNYIRHALGVVTVGNGKFYTLTTGANERRWGKMKDRLQTVIESFKISNV
ccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccEEEcccccEEEEcccccEEEEEcccEEEEEcccccccEEEEEEEccccccccccccHHHHHHHHHHHHccccccccEEEEEEEEccccCEEEEEEEEEEcccccEEEEEEEEEEccEEEEEEEECccHHHHHHHHHHHHHHcccEEccc
******************N*******************RGISLIVKAEHA********LDKCGRRQMIAVGVIAPWVSLVNQTPPSFAAESNKGFLSVTDKKDGYSFVYPFGWQEVIIEGQDKVFKDVIEPLESVSVNLIPTGKQDIRDFGPPQEVAETLIKKFLAPPTQKTKIIAASENDVDGKAYYAFEFTAQAPNYIRHALGVVTVGNGKFYTLTTGANERRWGKMKDRLQTVIESFKISNV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASLQHSPSSSIHQTSFLNSLPQLGVQKYGGVLPAVCRRGISLIVKAEHASMASSANSLDKCGRRQMIAVGVIAPWVSLVNQTPPSFAAESNKGFLSVTDKKDGYSFVYPFGWQEVIIEGQDKVFKDVIEPLESVSVNLIPTGKQDIRDFGPPQEVAETLIKKFLAPPTQKTKIIAASENDVDGKAYYAFEFTAQAPNYIRHALGVVTVGNGKFYTLTTGANERRWGKMKDRLQTVIESFKISNV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
PsbP-like protein 1, chloroplastic Required for efficient repair of photodamaged PSII, but not tightly associated with the complex.probableP82538

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LNJ, chain A
Confidence level:very confident
Coverage over the Query: 90-243
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
2vu4, chain Aconfident Alignment | Template Structure