Citrus Sinensis ID: 025987

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-----
MAAPTVEGAAVTALRSVLHRVRQAAERSGRTQEQIRVVAVSKTKPVSLIRQVYDAGHRSFGENYVQEIVDKAPQLPEDIKWHFVGHLQSNKAKTLLGGVPNLDMVEGVGNEKIANHLDKAVSNLGRKPLKVLVQVNTSGEESKSGIDPSSCLGIVEHVRLRCPNLEFSGLMTIGMPDYTSTPENFRTLLNCRAEVCKALGMAEDQCELSMGMSGDFEQAIEMGSTSVRIGSTIFGPREYAKKQQN
cccccHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHHccccccHHHHHHHHHHHHcccccccEEEEcccccccHHHHccccccccEEEEccHHHHHHHHHHHHHHcccccccEEEEEEcccccccccccHHHHHHHHHHHHHcccccEEEEEEccccccccccHHHHHHHHHHHHHHHHHHcccccccEEccccccHHHHHHHHcccEEEEcccccccccccccccc
*********AVTALRSVLHRVRQAAERSGRTQEQIRVVAVSKTKPVSLIRQVYDAGHRSFGENYVQEIVDKAPQLPEDIKWHFVGHLQSNKAKTLLGGVPNLDMVEGVGNEKIANHLDKAVSNLGRKPLKVLVQVNTSGEESKSGIDPSSCLGIVEHVRLRCPNLEFSGLMTIGMPDYTSTPENFRTLLNCRAEVCKALGMAEDQCELSMGMSGDFEQAIEMGSTSVRIGSTIF***********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAPTVEGAAVTALRSVLHRVRQAAERSGRTQEQIRVVAVSKTKPVSLIRQVYDAGHRSFGENYVQEIVDKAPQLPEDIKWHFVGHLQSNKAKTLLGGVPNLDMVEGVGNEKIANHLDKAVSNLGRKPLKVLVQVNTSGEESKSGIDPSSCLGIVEHVRLRCPNLEFSGLMTIGMPDYTSTPENFRTLLNCRAEVCKALGMAEDQCELSMGMSGDFEQAIEMGSTSVRIGSTIFGPREYAKKQQN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Proline synthase co-transcribed bacterial homolog protein probableQ5R4Z1
Proline synthase co-transcribed bacterial homolog protein probableO94903
Proline synthase co-transcribed bacterial homolog protein probableQ9Z2Y8

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3R79, chain A
Confidence level:very confident
Coverage over the Query: 9-242
View the alignment between query and template
View the model in PyMOL