Citrus Sinensis ID: 026011

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-----
MASYSMPFSAAFSSPLRHFTQIKTCPAAWASSMAASWTPTNSIKSSIGSAKPGFLQHGLFSQSSNLPGFFVKRRSFGVHATAATEKSLYDFTVKDIDGKDVPLSKFKGKVLLIVNVASRCGLTPSNYSELSHLYEKYKTQGFEILAFPCNQFGGQEPGSNPEIKEFACTRFKAEFPIFDKVDVNGPNTAPVYQFLKSSAGGFLGDLVKWNFEKFLVDKNGKVIERYPPTTSPFQIEKDIQKLVVA
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccCEECcccccccccccccccccEEEEcccccccccccccccEEEEEEcccccccccccHHHHHHHHHHHcccccEEEEcccccccccccccHHHHHHHHHHcccccccccccEEcccccccHHHHHHHcccccccccccccccEEEEEcccccEEEEccccccHHHHHHHHHHHHcc
************SSPLRHF************************************QHGLFSQSSNLPGFFV***********ATEKSLYDFTVKDIDGKDVPLSKFKGKVLLIVNVASRCGLTPSNYSELSHLYEKYKTQGFEILAFPCNQFGGQEPGSNPEIKEFACTRFKAEFPIFDKVDVNGPNTAPVYQFLKSSAGGFLGDLVKWNFEKFLVDKNGKVIERYPPTTSPFQIEKDIQKLVVA
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASYSMPFSAAFSSPLRHFTQIKTCPAAWASSMAASWTPTNSIKSSIGSAKPGFLQHGLFSQSSNLPGFFVKRRSFGVHATAATEKSLYDFTVKDIDGKDVPLSKFKGKVLLIVNVASRCGLTPSNYSELSHLYEKYKTQGFEILAFPCNQFGGQEPGSNPEIKEFACTRFKAEFPIFDKVDVNGPNTAPVYQFLKSSAGGFLGDLVKWNFEKFLVDKNGKVIERYPPTTSPFQIEKDIQKLVVA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Putative glutathione peroxidase 7, chloroplastic May constitute a glutathione peroxidase-like protective system against oxidative stresses.probableQ9SZ54
Phospholipid hydroperoxide glutathione peroxidase, chloroplastic Protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione.probableO24296
Probable phospholipid hydroperoxide glutathione peroxidase Protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione.probableO24031

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.11.-.-Acting on a peroxide as acceptor.probable
1.11.1.-Peroxidases.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2P5Q, chain A
Confidence level:very confident
Coverage over the Query: 86-245
View the alignment between query and template
View the model in PyMOL