Citrus Sinensis ID: 026014


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240----
MTRKELASEARERTMKILKKTMNIFRKKTTPKEALRESKRDMATATRGVEREIAALQLEEKKLVAEIKKTAKTGNEAATRILARQLVRLRQQITNLQGSRAQIRGVATHTQALYASTSISTGMRGATKAMVAMNQQMKPAKQAKLIKEFQKQSAQMDMTIEMMSESIDETLDKDEAEEETEELTNQVLDEIGVDIASQLSSAPKGRIASRNAPNAVANAPKTNTSSESADVEDLEKRFASLRRI
ccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHcc
*******************************************************L*****KLVAEIK*****GNEAATRILARQLVRLRQQITNLQGSRAQIRGVATHTQALYAST*********TKAMVAMNQ*MKPAKQAKLIK**************************DEAEEETEELTNQVLDEIGVDIA****************************************RFASLRR*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTRKELASEARERTMKILKKTMNIFRKKTTPKEALRESKRDMATATRGVEREIAALQLEEKKLVAEIKKTAKTGNEAATRILARQLVRLRQQITNLQGSRAQIRGVATHTQALYASTSISTGMRGATKAMVAMNQQMKPAKQAKLIKEFQKQSAQMDMTIEMMSExxxxxxxxxxxxxxxxxxxxxVLDEIGVDIASQLSSAPKGRIASRNAPNAVANAPKTNTSSESADVEDLEKRFASLRRI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Vacuolar protein sorting-associated protein 2 homolog 2 Component of the ESCRT-III complex, which is required for multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. The ESCRT-III complex is probably involved in the concentration of MVB cargo.confidentQ0WTY4
Charged multivesicular body protein 2b Probable core component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids.probableQ6NXD2
Charged multivesicular body protein 2b Probable core component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids.probableQ6NVL7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3FRT, chain A
Confidence level:very confident
Coverage over the Query: 31-161
View the alignment between query and template
View the model in PyMOL
Template: 1I84, chain S
Confidence level:probable
Coverage over the Query: 3-51
View the alignment between query and template
View the model in PyMOL