Citrus Sinensis ID: 026023


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240----
MAKPVSIEVWNPNGKYRVVSTKPMPGTRWINLLIEQDCRVEICTQKKTILSVEDIIALIGDKCDGVIGQLTEDWGETLFAALSRAGGKAFSNMAVGYNNVDVNAANKYGIAVGNTPGVLTETTAELAASLSLAAARRIVEADEFMRAGLYDGWLPNLFVGNLLKGQTVGVIGAGRIGSAYARMMVEGFKMNLIYYDLYQATRLEKFVTAYGQFLKANGEQPVTWKRASSMDEVLREADVVCTLC
ccccccccccccccccEEEEEccccHHHHHHHHHHcccEEEEEccccccccHHHHHHHHcccccEEEEcccccccHHHHHHcccccccEEEEEccccccccHHHHHHcccEEEcccccccHHHHHHHHHHHHHHcccHHHHHHHHHccccccccccccccccccccEEEEEcccHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHHHccccccccccccEEccHHHHHHHccEEEEcc
cccccEEEEEccccccEEEEEccccHHHHHHHHHHcccEEEEEccccccccHHHHHHHHHccccEEEEEccccccHHHHHHcccccccEEEEEccccccEcHHHHHHcccEEEccccccHHHHHHHHHHHHHHHHccHHHHHHHHHcccccccccccccEccccccEEEEEcccHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHcccHHHcccccccHccccEEccHHHHHHHccEEEEEc
makpvsievwnpngkyrvvstkpmpgtrWINLLIEQDCRVEICTQKKTILSVEDIIALIGDKCDGVIGQLTEDWGETLFAALSRAGGKAFSNMAvgynnvdvnaankygiavgntpgvlTETTAELAASLSLAAARRIVEADEFMraglydgwlpnlfvgnllkgqtvgvigagrIGSAYARMMVEGFKMNLIYYDLYQATRLEKFVTAYGQFLkangeqpvtwkrASSMDEVLREADVVCTLC
makpvsievwnpngkyrvvstkpmpGTRWINLLIEQDCRVEICTQKKTILSVEDIIALIGDKCDGVIGQLTEDWGETLFAALSRAGGKAFSNMAVGYNNVDVNAANKYGIAVGNTPGVLTETTAELAASLSLAAARRIVEADEFMRAGLYDGWLPNLFVGNLLKGQTVGVIGAGRIGSAYARMMVEGFKMNLIYYDLYQATRLEKFVTAYGQFlkangeqpvtwkRASSMDEVLREADVVCTLC
MAKPVSIEVWNPNGKYRVVSTKPMPGTRWINLLIEQDCRVEICTQKKTILSVEDIIALIGDKCDGVIGQLTEDWGETLFAALSRAGGKAFSNMAVGYNNVDVNAANKYGIAVGNTPGVltettaelaaslslaaaRRIVEADEFMRAGLYDGWLPNLFVGNLLKGQTVGVIGAGRIGSAYARMMVEGFKMNLIYYDLYQATRLEKFVTAYGQFLKANGEQPVTWKRASSMDEVLREADVVCTLC
******IEVWNPNGKYRVVSTKPMPGTRWINLLIEQDCRVEICTQKKTILSVEDIIALIGDKCDGVIGQLTEDWGETLFAALSRAGGKAFSNMAVGYNNVDVNAANKYGIAVGNTPGVLTETTAELAASLSLAAARRIVEADEFMRAGLYDGWLPNLFVGNLLKGQTVGVIGAGRIGSAYARMMVEGFKMNLIYYDLYQATRLEKFVTAYGQFLKANGEQPVTWKRA****EVLREADVVC***
*****************VVSTKPMPGTRWINLLIEQDCRVEICTQKKTILSVEDIIALIGDKCDGVIGQLTEDWGETLFAALSRAGGKAFSNMAVGYNNVDVNAANKYGIAVGNTPGVLTETTAELAASLSLAAARRIVEADEFMRAGLYDGWLPNLFVGNLLKGQTVGVIGAGRIGSAYARMMVEGFKMNLIYYDLYQATRLEKFVTAYGQFLKANGEQPVTWKRASSMDEVLREADVVCTLC
MAKPVSIEVWNPNGKYRVVSTKPMPGTRWINLLIEQDCRVEICTQKKTILSVEDIIALIGDKCDGVIGQLTEDWGETLFAALSRAGGKAFSNMAVGYNNVDVNAANKYGIAVGNTPGVLTETTAELAASLSLAAARRIVEADEFMRAGLYDGWLPNLFVGNLLKGQTVGVIGAGRIGSAYARMMVEGFKMNLIYYDLYQATRLEKFVTAYGQFLKANGEQPVTWKRASSMDEVLREADVVCTLC
**KPVSIEVWNPNGKYRVVSTKPMPGTRWINLLIEQDCRVEICTQKKTILSVEDIIALIGDKCDGVIGQLTEDWGETLFAALSRAGGKAFSNMAVGYNNVDVNAANKYGIAVGNTPGVLTETTAELAASLSLAAARRIVEADEFMRAGLYDGWLPNLFVGNLLKGQTVGVIGAGRIGSAYARMMVEGFKMNLIYYDLYQATRLEKFVTAYGQFLKANGEQPVTWKRASSMDEVLREADVVCTLC
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKPVSIEVWNPNGKYRVVSTKPMPGTRWINLLIEQDCRVEICTQKKTILSVEDIIALIGDKCDGVIGQLTEDWGETLFAALSRAGGKAFSNMAVGYNNVDVNAANKYGIAVGNTPGVLTETTAELAASLSLAAARRIVEADEFMRAGLYDGWLPNLFVGNLLKGQTVGVIGAGRIGSAYARMMVEGFKMNLIYYDLYQATRLEKFVTAYGQFLKANGEQPVTWKRASSMDEVLREADVVCTLC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query244 2.2.26 [Sep-21-2011]
P13443 382 Glycerate dehydrogenase O N/A no 0.987 0.630 0.941 1e-126
Q9C9W5 386 Glycerate dehydrogenase H yes no 0.987 0.624 0.921 1e-123
Q5JEZ2 333 Glyoxylate reductase OS=P yes no 0.770 0.564 0.347 2e-25
B6YWH0 334 Glyoxylate reductase OS=T yes no 0.848 0.619 0.341 1e-24
Q9YAW4 335 Glyoxylate reductase OS=A yes no 0.561 0.408 0.405 2e-24
B1L765 332 Glyoxylate reductase OS=K yes no 0.737 0.542 0.403 3e-24
Q8U3Y2 336 Glyoxylate reductase OS=P yes no 0.692 0.502 0.352 1e-23
A1RYE4 339 Glyoxylate reductase OS=T yes no 0.713 0.513 0.372 1e-22
Q9C4M5 331 Glyoxylate reductase OS=T N/A no 0.602 0.444 0.418 9e-21
O32264325 Probable 2-ketogluconate yes no 0.737 0.553 0.338 9e-19
>sp|P13443|DHGY_CUCSA Glycerate dehydrogenase OS=Cucumis sativus GN=HPR-A PE=2 SV=1 Back     alignment and function desciption
 Score =  452 bits (1162), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 227/241 (94%), Positives = 236/241 (97%)

Query: 1   MAKPVSIEVWNPNGKYRVVSTKPMPGTRWINLLIEQDCRVEICTQKKTILSVEDIIALIG 60
           MAKPV IEVWNPNGKYRVVSTKPMPGTRWINLLIEQDCRVEICT+KKTILSVEDI+ALIG
Sbjct: 1   MAKPVQIEVWNPNGKYRVVSTKPMPGTRWINLLIEQDCRVEICTEKKTILSVEDILALIG 60

Query: 61  DKCDGVIGQLTEDWGETLFAALSRAGGKAFSNMAVGYNNVDVNAANKYGIAVGNTPGVLT 120
           DKCDGVIGQLTEDWGE LF+ALSRAGGKAFSNMAVGYNNVDVNAANKYG+AVGNTPGVLT
Sbjct: 61  DKCDGVIGQLTEDWGEVLFSALSRAGGKAFSNMAVGYNNVDVNAANKYGVAVGNTPGVLT 120

Query: 121 ETTAELAASLSLAAARRIVEADEFMRAGLYDGWLPNLFVGNLLKGQTVGVIGAGRIGSAY 180
           ETTAELAASLSLAAARRIVEADEFMRAG YDGWLPNLFVGNLLKGQTVGVIGAGRIGSAY
Sbjct: 121 ETTAELAASLSLAAARRIVEADEFMRAGRYDGWLPNLFVGNLLKGQTVGVIGAGRIGSAY 180

Query: 181 ARMMVEGFKMNLIYYDLYQATRLEKFVTAYGQFLKANGEQPVTWKRASSMDEVLREADVV 240
           ARMMVEGFKMNLIY+DLYQ+TRLEKFVTAYG+FLKANGE PVTW+RASSMDEVLREADV+
Sbjct: 181 ARMMVEGFKMNLIYFDLYQSTRLEKFVTAYGEFLKANGEAPVTWRRASSMDEVLREADVI 240

Query: 241 C 241
            
Sbjct: 241 S 241





Cucumis sativus (taxid: 3659)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 2EC: 9
>sp|Q9C9W5|HPR1_ARATH Glycerate dehydrogenase HPR, peroxisomal OS=Arabidopsis thaliana GN=HPR PE=1 SV=1 Back     alignment and function description
>sp|Q5JEZ2|GYAR_PYRKO Glyoxylate reductase OS=Pyrococcus kodakaraensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=gyaR PE=3 SV=1 Back     alignment and function description
>sp|B6YWH0|GYAR_THEON Glyoxylate reductase OS=Thermococcus onnurineus (strain NA1) GN=gyaR PE=3 SV=1 Back     alignment and function description
>sp|Q9YAW4|GYAR_AERPE Glyoxylate reductase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=gyaR PE=3 SV=2 Back     alignment and function description
>sp|B1L765|GYAR_KORCO Glyoxylate reductase OS=Korarchaeum cryptofilum (strain OPF8) GN=gyaR PE=3 SV=1 Back     alignment and function description
>sp|Q8U3Y2|GYAR_PYRFU Glyoxylate reductase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=gyaR PE=3 SV=1 Back     alignment and function description
>sp|A1RYE4|GYAR_THEPD Glyoxylate reductase OS=Thermofilum pendens (strain Hrk 5) GN=gyaR PE=3 SV=1 Back     alignment and function description
>sp|Q9C4M5|GYAR_THELI Glyoxylate reductase OS=Thermococcus litoralis GN=gyaR PE=1 SV=1 Back     alignment and function description
>sp|O32264|TKRA_BACSU Probable 2-ketogluconate reductase OS=Bacillus subtilis (strain 168) GN=yvcT PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query244
225428049 386 PREDICTED: glycerate dehydrogenase [Viti 0.983 0.621 0.941 1e-126
147805559 386 hypothetical protein VITISV_020147 [Viti 0.983 0.621 0.941 1e-126
13873334 386 hydroxypyruvate reductase [Bruguiera gym 0.983 0.621 0.95 1e-126
118489484 386 unknown [Populus trichocarpa x Populus d 0.987 0.624 0.950 1e-126
255581842 386 hydroxypyruvate reductase, putative [Ric 0.987 0.624 0.958 1e-126
224078341 386 predicted protein [Populus trichocarpa] 0.987 0.624 0.946 1e-125
449454213 382 PREDICTED: glycerate dehydrogenase-like 0.987 0.630 0.941 1e-125
388493492 388 unknown [Lotus japonicus] 0.987 0.621 0.925 1e-123
1304042 386 hydroxypyruvate reductase [Cucurbita cv. 0.983 0.621 0.933 1e-122
1304044 381 hydroxypyruvate reductase [Cucurbita cv. 0.983 0.629 0.933 1e-122
>gi|225428049|ref|XP_002279281.1| PREDICTED: glycerate dehydrogenase [Vitis vinifera] gi|297744600|emb|CBI37862.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  458 bits (1178), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 226/240 (94%), Positives = 239/240 (99%)

Query: 1   MAKPVSIEVWNPNGKYRVVSTKPMPGTRWINLLIEQDCRVEICTQKKTILSVEDIIALIG 60
           MAKPVSIEVWNP GKYRVVSTKPMPGTRWI+LL++QDCRVEICTQKKTILSVEDIIALIG
Sbjct: 1   MAKPVSIEVWNPCGKYRVVSTKPMPGTRWIDLLVQQDCRVEICTQKKTILSVEDIIALIG 60

Query: 61  DKCDGVIGQLTEDWGETLFAALSRAGGKAFSNMAVGYNNVDVNAANKYGIAVGNTPGVLT 120
           DKCDGVIGQLTEDWGETLF+ALSRAGG+AFSNMAVGYNNVDVNAANKYG+AVGNTPGVLT
Sbjct: 61  DKCDGVIGQLTEDWGETLFSALSRAGGRAFSNMAVGYNNVDVNAANKYGVAVGNTPGVLT 120

Query: 121 ETTAELAASLSLAAARRIVEADEFMRAGLYDGWLPNLFVGNLLKGQTVGVIGAGRIGSAY 180
           ETTAELAASLS+AAARRIVEADEFMRAGLYDGWLP+LFVGNLL+GQTVGVIGAGRIGSAY
Sbjct: 121 ETTAELAASLSMAAARRIVEADEFMRAGLYDGWLPHLFVGNLLRGQTVGVIGAGRIGSAY 180

Query: 181 ARMMVEGFKMNLIYYDLYQATRLEKFVTAYGQFLKANGEQPVTWKRASSMDEVLREADVV 240
           ARMMVEGFKMNLIYYDLYQATRLEKFVTAYGQFLKA+GEQPVTWKRA+SMDEVLREAD++
Sbjct: 181 ARMMVEGFKMNLIYYDLYQATRLEKFVTAYGQFLKASGEQPVTWKRAASMDEVLREADLI 240




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147805559|emb|CAN65023.1| hypothetical protein VITISV_020147 [Vitis vinifera] Back     alignment and taxonomy information
>gi|13873334|dbj|BAB44155.1| hydroxypyruvate reductase [Bruguiera gymnorhiza] Back     alignment and taxonomy information
>gi|118489484|gb|ABK96544.1| unknown [Populus trichocarpa x Populus deltoides] Back     alignment and taxonomy information
>gi|255581842|ref|XP_002531721.1| hydroxypyruvate reductase, putative [Ricinus communis] gi|223528624|gb|EEF30641.1| hydroxypyruvate reductase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224078341|ref|XP_002305524.1| predicted protein [Populus trichocarpa] gi|222848488|gb|EEE86035.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449454213|ref|XP_004144850.1| PREDICTED: glycerate dehydrogenase-like [Cucumis sativus] gi|449508825|ref|XP_004163421.1| PREDICTED: glycerate dehydrogenase-like [Cucumis sativus] gi|118564|sp|P13443.1|DHGY_CUCSA RecName: Full=Glycerate dehydrogenase; Short=GDH; AltName: Full=NADH-dependent hydroxypyruvate reductase; Short=HPR gi|18264|emb|CAA41434.1| NADH-dependent hydroxypyruvate reductase [Cucumis sativus] gi|18275|emb|CAA32764.1| unnamed protein product [Cucumis sativus] Back     alignment and taxonomy information
>gi|388493492|gb|AFK34812.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|1304042|dbj|BAA08410.1| hydroxypyruvate reductase [Cucurbita cv. Kurokawa Amakuri] Back     alignment and taxonomy information
>gi|1304044|dbj|BAA08411.1| hydroxypyruvate reductase [Cucurbita cv. Kurokawa Amakuri] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query244
TIGR_CMR|BA_1434 323 BA_1434 "D-isomer specific 2-h 0.651 0.492 0.337 4.6e-18
TIGR_CMR|SPO_0913317 SPO_0913 "D-isomer specific 2- 0.713 0.548 0.297 4.1e-17
UNIPROTKB|Q0BWN7328 gyaR "Glyoxylate reductase" [H 0.778 0.579 0.298 9.3e-17
UNIPROTKB|G4NFT6 349 MGG_08725 "D-lactate dehydroge 0.586 0.409 0.312 2.6e-15
TIGR_CMR|SPO_1570330 SPO_1570 "D-isomer specific 2- 0.717 0.530 0.280 5.3e-15
TIGR_CMR|BA_5135330 BA_5135 "D-isomer specific 2-h 0.774 0.572 0.274 1.6e-13
FB|FBgn0037370 362 CG1236 [Drosophila melanogaste 0.864 0.582 0.287 2.8e-13
TAIR|locus:2090649 588 AT3G19480 [Arabidopsis thalian 0.709 0.294 0.313 3.9e-13
UNIPROTKB|Q48MK5 324 PSPPH_1099 "D-isomer specific 0.553 0.416 0.317 5.4e-13
TIGR_CMR|CHY_2698 525 CHY_2698 "D-3-phosphoglycerate 0.688 0.32 0.305 1.4e-12
TIGR_CMR|BA_1434 BA_1434 "D-isomer specific 2-hydroxyacid dehydrogenase family protein" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
 Score = 219 (82.2 bits), Expect = 4.6e-18, P = 4.6e-18
 Identities = 56/166 (33%), Positives = 86/166 (51%)

Query:    30 INLLIEQDCRVEICTQKKTILSVEDIIALIGDKCDGVIGQL-TEDWGETLFAALSRAGGK 88
             I L + +D  VE+   K+ ++S++++   + DK D ++  L T+   E + AA S    K
Sbjct:    13 IGLELLKDHDVEMY-DKEELISLDELTERVKDK-DALLSLLSTKVTKEVIDAAPSL---K 67

Query:    89 AFSNMAVGYNNVDVNAANKYGIAVGNTPGVXXXXXXXXXXXXXXXXXRRIVEADEFMRAG 148
               +N   GY+N+D   A + GIAV NTP V                 RRI E D   R  
Sbjct:    68 IVANYGAGYDNIDYTYAGEKGIAVTNTPKVSTEATAELTFALLLAAARRIPEGDTLCRTT 127

Query:   149 LYDGWLPNLFVGNLLKGQTVGVIGAGRIGSAYARMMVEGFKMNLIY 194
              ++GW P  F+G  + G+T+G+IG G IG A A+   + F MN++Y
Sbjct:   128 GFNGWAPLFFLGREVHGKTIGIIGLGEIGKAVAKR-AKAFGMNILY 172




GO:0008152 "metabolic process" evidence=ISS
GO:0016491 "oxidoreductase activity" evidence=ISS
TIGR_CMR|SPO_0913 SPO_0913 "D-isomer specific 2-hydroxyacid dehydrogenase family protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
UNIPROTKB|Q0BWN7 gyaR "Glyoxylate reductase" [Hyphomonas neptunium ATCC 15444 (taxid:228405)] Back     alignment and assigned GO terms
UNIPROTKB|G4NFT6 MGG_08725 "D-lactate dehydrogenase" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_1570 SPO_1570 "D-isomer specific 2-hydroxyacid dehydrogenase family protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|BA_5135 BA_5135 "D-isomer specific 2-hydroxyacid dehydrogenase family protein" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
FB|FBgn0037370 CG1236 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
TAIR|locus:2090649 AT3G19480 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q48MK5 PSPPH_1099 "D-isomer specific 2-hydroxyacid dehydrogenase family protein" [Pseudomonas syringae pv. phaseolicola 1448A (taxid:264730)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_2698 CHY_2698 "D-3-phosphoglycerate dehydrogenase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9C9W5HPR1_ARATH1, ., 1, ., 1, ., 2, 90.92110.98770.6243yesno
P13443DHGY_CUCSA1, ., 1, ., 1, ., 2, 90.94190.98770.6308N/Ano

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.10.963

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00036132001
SubName- Full=Chromosome chr3 scaffold_8, whole genome shotgun sequence; (418 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00022240001
SubName- Full=Chromosome chr6 scaffold_25, whole genome shotgun sequence; (401 aa)
     0.664
GSVIVG00034383001
SubName- Full=Putative uncharacterized protein (Chromosome chr9 scaffold_7, whole genome shotgu [...] (144 aa)
       0.442
GSVIVG00025097001
SubName- Full=Putative uncharacterized protein (Chromosome chr4 scaffold_32, whole genome shotg [...] (221 aa)
       0.416
GSVIVG00015518001
SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (99 aa)
       0.412
GSVIVG00011932001
SubName- Full=Chromosome undetermined scaffold_2569, whole genome shotgun sequence; (393 aa)
       0.412
GSVIVG00015393001
SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (270 aa)
       0.411
GSVIVG00037644001
SubName- Full=Chromosome chr9 scaffold_90, whole genome shotgun sequence; (395 aa)
       0.408
GSVIVG00036212001
SubName- Full=Chromosome chr3 scaffold_8, whole genome shotgun sequence; (397 aa)
       0.406
GSVIVG00026129001
SubName- Full=Chromosome chr15 scaffold_37, whole genome shotgun sequence; (273 aa)
       0.402
GSVIVG00024835001
SubName- Full=Chromosome chr6 scaffold_3, whole genome shotgun sequence; (329 aa)
       0.400

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query244
PLN02306 386 PLN02306, PLN02306, hydroxypyruvate reductase 0.0
cd05301 309 cd05301, GDH, D-glycerate dehydrogenase/hydroxypyr 2e-76
cd12172 306 cd12172, PGDH_like_2, Putative D-3-Phosphoglycerat 4e-43
cd12178 317 cd12178, 2-Hacid_dh_13, Putative D-isomer specific 2e-40
cd05198 302 cd05198, formate_dh_like, Formate/glycerate and re 5e-39
PRK13243 333 PRK13243, PRK13243, glyoxylate reductase; Reviewed 7e-39
COG1052 324 COG1052, LdhA, Lactate dehydrogenase and related d 1e-38
cd12173 304 cd12173, PGDH_4, Phosphoglycerate dehydrogenases, 2e-38
pfam00389312 pfam00389, 2-Hacid_dh, D-isomer specific 2-hydroxy 3e-35
COG0111 324 COG0111, SerA, Phosphoglycerate dehydrogenase and 1e-33
cd05303301 cd05303, PGDH_2, Phosphoglycerate dehydrogenase (P 2e-28
cd05299 312 cd05299, CtBP_dh, C-terminal binding protein (CtBP 3e-28
cd12186 329 cd12186, LDH, D-Lactate dehydrogenase and D-2-Hydr 4e-28
cd12177 321 cd12177, 2-Hacid_dh_12, Putative D-isomer specific 2e-27
cd12157 318 cd12157, PTDH, Thermostable Phosphite Dehydrogenas 2e-27
cd12175 311 cd12175, 2-Hacid_dh_11, Putative D-isomer specific 3e-27
PRK13581 526 PRK13581, PRK13581, D-3-phosphoglycerate dehydroge 6e-27
cd12156301 cd12156, HPPR, Hydroxy(phenyl)pyruvate Reductase, 1e-25
cd12171 310 cd12171, 2-Hacid_dh_10, Putative D-isomer specific 1e-25
cd12183 328 cd12183, LDH_like_2, D-Lactate and related Dehydro 1e-23
cd01619 323 cd01619, LDH_like, D-Lactate and related Dehydroge 1e-23
TIGR01327 525 TIGR01327, PGDH, D-3-phosphoglycerate dehydrogenas 2e-23
cd12168 321 cd12168, Mand_dh_like, D-Mandelate Dehydrogenase-l 2e-23
cd12174 305 cd12174, PGDH_like_3, Putative D-3-Phosphoglycerat 6e-23
PRK15409 323 PRK15409, PRK15409, bifunctional glyoxylate/hydrox 1e-22
pfam02826175 pfam02826, 2-Hacid_dh_C, D-isomer specific 2-hydro 1e-22
cd12187 329 cd12187, LDH_like_1, D-Lactate and related Dehydro 3e-20
cd12162 307 cd12162, 2-Hacid_dh_4, Putative D-isomer specific 3e-19
cd12161 315 cd12161, GDH_like_1, Putative glycerate dehydrogen 4e-19
cd12169 308 cd12169, PGDH_like_1, Putative D-3-Phosphoglycerat 5e-19
cd12185 322 cd12185, HGDH_LDH_like, Putative Lactate dehydroge 1e-18
cd12176 304 cd12176, PGDH_3, Phosphoglycerate dehydrogenases, 2e-18
PRK08605 332 PRK08605, PRK08605, D-lactate dehydrogenase; Valid 6e-16
cd12167 330 cd12167, 2-Hacid_dh_8, Putative D-isomer specific 2e-15
cd12165 314 cd12165, 2-Hacid_dh_6, Putative D-isomer specific 2e-14
cd12184 330 cd12184, HGDH_like, (R)-2-Hydroxyglutarate Dehydro 4e-14
PRK11790 409 PRK11790, PRK11790, D-3-phosphoglycerate dehydroge 5e-13
PRK08410311 PRK08410, PRK08410, 2-hydroxyacid dehydrogenase; P 1e-12
PLN02928 347 PLN02928, PLN02928, oxidoreductase family protein 4e-11
PRK06487317 PRK06487, PRK06487, glycerate dehydrogenase; Provi 8e-11
cd12179 306 cd12179, 2-Hacid_dh_14, Putative D-isomer specific 8e-11
PRK12480 330 PRK12480, PRK12480, D-lactate dehydrogenase; Provi 1e-10
cd05302 348 cd05302, FDH, NAD-dependent Formate Dehydrogenase 6e-10
PRK07574 385 PRK07574, PRK07574, formate dehydrogenase; Provisi 3e-09
PRK06932 314 PRK06932, PRK06932, glycerate dehydrogenase; Provi 7e-08
cd12158 343 cd12158, ErythrP_dh, D-Erythronate-4-Phosphate Deh 4e-07
cd12166300 cd12166, 2-Hacid_dh_7, Putative D-isomer specific 7e-06
cd12159 303 cd12159, 2-Hacid_dh_2, Putative D-isomer specific 8e-06
PRK06436 303 PRK06436, PRK06436, glycerate dehydrogenase; Provi 9e-06
cd05300 313 cd05300, 2-Hacid_dh_1, Putative D-isomer specific 2e-05
PLN03139 386 PLN03139, PLN03139, formate dehydrogenase; Provisi 9e-05
cd12155 314 cd12155, PGDH_1, Phosphoglycerate Dehydrogenase, 2 0.001
cd12154310 cd12154, FDH_GDH_like, Formate/glycerate dehydroge 0.002
TIGR03944 327 TIGR03944, dehyd_SbnB_fam, 2,3-diaminopropionate b 0.004
>gnl|CDD|177941 PLN02306, PLN02306, hydroxypyruvate reductase Back     alignment and domain information
 Score =  509 bits (1313), Expect = 0.0
 Identities = 228/240 (95%), Positives = 239/240 (99%)

Query: 1   MAKPVSIEVWNPNGKYRVVSTKPMPGTRWINLLIEQDCRVEICTQKKTILSVEDIIALIG 60
           MAKPVSIEV+NPNGKYRVVSTKPMPGTRWINLL++QDCRVEICT+KKTILSVEDIIALIG
Sbjct: 1   MAKPVSIEVYNPNGKYRVVSTKPMPGTRWINLLVDQDCRVEICTEKKTILSVEDIIALIG 60

Query: 61  DKCDGVIGQLTEDWGETLFAALSRAGGKAFSNMAVGYNNVDVNAANKYGIAVGNTPGVLT 120
           DKCDGVIGQLTEDWGETLF+ALS+AGGKAFSNMAVGYNNVDV AANKYGIAVGNTPGVLT
Sbjct: 61  DKCDGVIGQLTEDWGETLFSALSKAGGKAFSNMAVGYNNVDVEAANKYGIAVGNTPGVLT 120

Query: 121 ETTAELAASLSLAAARRIVEADEFMRAGLYDGWLPNLFVGNLLKGQTVGVIGAGRIGSAY 180
           ETTAELAASLSLAAARRIVEADEFMRAGLY+GWLP+LFVGNLLKGQTVGVIGAGRIGSAY
Sbjct: 121 ETTAELAASLSLAAARRIVEADEFMRAGLYEGWLPHLFVGNLLKGQTVGVIGAGRIGSAY 180

Query: 181 ARMMVEGFKMNLIYYDLYQATRLEKFVTAYGQFLKANGEQPVTWKRASSMDEVLREADVV 240
           ARMMVEGFKMNLIYYDLYQ+TRLEKFVTAYGQFLKANGEQPVTWKRASSM+EVLREADV+
Sbjct: 181 ARMMVEGFKMNLIYYDLYQSTRLEKFVTAYGQFLKANGEQPVTWKRASSMEEVLREADVI 240


Length = 386

>gnl|CDD|240626 cd05301, GDH, D-glycerate dehydrogenase/hydroxypyruvate reductase (GDH) Back     alignment and domain information
>gnl|CDD|240649 cd12172, PGDH_like_2, Putative D-3-Phosphoglycerate Dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240655 cd12178, 2-Hacid_dh_13, Putative D-isomer specific 2-hydroxyacid dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240622 cd05198, formate_dh_like, Formate/glycerate and related dehydrogenases of the D-specific 2-hydroxy acid dehydrogenase family Back     alignment and domain information
>gnl|CDD|183914 PRK13243, PRK13243, glyoxylate reductase; Reviewed Back     alignment and domain information
>gnl|CDD|223980 COG1052, LdhA, Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|240650 cd12173, PGDH_4, Phosphoglycerate dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|215893 pfam00389, 2-Hacid_dh, D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain Back     alignment and domain information
>gnl|CDD|223189 COG0111, SerA, Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|240628 cd05303, PGDH_2, Phosphoglycerate dehydrogenase (PGDH) NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240624 cd05299, CtBP_dh, C-terminal binding protein (CtBP), D-isomer-specific 2-hydroxyacid dehydrogenases related repressor Back     alignment and domain information
>gnl|CDD|240662 cd12186, LDH, D-Lactate dehydrogenase and D-2-Hydroxyisocaproic acid dehydrogenase (D-HicDH), NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240654 cd12177, 2-Hacid_dh_12, Putative D-isomer specific 2-hydroxyacid dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240634 cd12157, PTDH, Thermostable Phosphite Dehydrogenase Back     alignment and domain information
>gnl|CDD|240652 cd12175, 2-Hacid_dh_11, Putative D-isomer specific 2-hydroxyacid dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|237436 PRK13581, PRK13581, D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|240633 cd12156, HPPR, Hydroxy(phenyl)pyruvate Reductase, D-isomer-specific 2-hydroxyacid-related dehydrogenase Back     alignment and domain information
>gnl|CDD|240648 cd12171, 2-Hacid_dh_10, Putative D-isomer specific 2-hydroxyacid dehydrogenases Back     alignment and domain information
>gnl|CDD|240659 cd12183, LDH_like_2, D-Lactate and related Dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240620 cd01619, LDH_like, D-Lactate and related Dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|233358 TIGR01327, PGDH, D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>gnl|CDD|240645 cd12168, Mand_dh_like, D-Mandelate Dehydrogenase-like dehydrogenases Back     alignment and domain information
>gnl|CDD|240651 cd12174, PGDH_like_3, Putative D-3-Phosphoglycerate Dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|185307 PRK15409, PRK15409, bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>gnl|CDD|217244 pfam02826, 2-Hacid_dh_C, D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain Back     alignment and domain information
>gnl|CDD|240663 cd12187, LDH_like_1, D-Lactate and related Dehydrogenase like proteins, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240639 cd12162, 2-Hacid_dh_4, Putative D-isomer specific 2-hydroxyacid dehydrogenases Back     alignment and domain information
>gnl|CDD|240638 cd12161, GDH_like_1, Putative glycerate dehydrogenase and related proteins of the D-specific 2-hydroxy dehydrogenase family Back     alignment and domain information
>gnl|CDD|240646 cd12169, PGDH_like_1, Putative D-3-Phosphoglycerate Dehydrogenases Back     alignment and domain information
>gnl|CDD|240661 cd12185, HGDH_LDH_like, Putative Lactate dehydrogenase and (R)-2-Hydroxyglutarate Dehydrogenase-like proteins, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240653 cd12176, PGDH_3, Phosphoglycerate dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|181499 PRK08605, PRK08605, D-lactate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|240644 cd12167, 2-Hacid_dh_8, Putative D-isomer specific 2-hydroxyacid dehydrogenases Back     alignment and domain information
>gnl|CDD|240642 cd12165, 2-Hacid_dh_6, Putative D-isomer specific 2-hydroxyacid dehydrogenases Back     alignment and domain information
>gnl|CDD|240660 cd12184, HGDH_like, (R)-2-Hydroxyglutarate Dehydrogenase and related dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|236985 PRK11790, PRK11790, D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181414 PRK08410, PRK08410, 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|215501 PLN02928, PLN02928, oxidoreductase family protein Back     alignment and domain information
>gnl|CDD|180588 PRK06487, PRK06487, glycerate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|240656 cd12179, 2-Hacid_dh_14, Putative D-isomer specific 2-hydroxyacid dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|183550 PRK12480, PRK12480, D-lactate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|240627 cd05302, FDH, NAD-dependent Formate Dehydrogenase (FDH) Back     alignment and domain information
>gnl|CDD|181041 PRK07574, PRK07574, formate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235890 PRK06932, PRK06932, glycerate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|240635 cd12158, ErythrP_dh, D-Erythronate-4-Phosphate Dehydrogenase NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240643 cd12166, 2-Hacid_dh_7, Putative D-isomer specific 2-hydroxyacid dehydrogenases Back     alignment and domain information
>gnl|CDD|240636 cd12159, 2-Hacid_dh_2, Putative D-isomer specific 2-hydroxyacid dehydrogenases Back     alignment and domain information
>gnl|CDD|235800 PRK06436, PRK06436, glycerate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|240625 cd05300, 2-Hacid_dh_1, Putative D-isomer specific 2-hydroxyacid dehydrogenase Back     alignment and domain information
>gnl|CDD|178684 PLN03139, PLN03139, formate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|240632 cd12155, PGDH_1, Phosphoglycerate Dehydrogenase, 2-hydroxyacid dehydrogenase family Back     alignment and domain information
>gnl|CDD|240631 cd12154, FDH_GDH_like, Formate/glycerate dehydrogenases, D-specific 2-hydroxy acid dehydrogenases and related dehydrogenases Back     alignment and domain information
>gnl|CDD|188459 TIGR03944, dehyd_SbnB_fam, 2,3-diaminopropionate biosynthesis protein SbnB Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 244
PLN02306 386 hydroxypyruvate reductase 100.0
COG1052 324 LdhA Lactate dehydrogenase and related dehydrogena 100.0
PRK15409 323 bifunctional glyoxylate/hydroxypyruvate reductase 100.0
COG0111 324 SerA Phosphoglycerate dehydrogenase and related de 100.0
PRK08410 311 2-hydroxyacid dehydrogenase; Provisional 100.0
PRK11790 409 D-3-phosphoglycerate dehydrogenase; Provisional 100.0
PRK13243 333 glyoxylate reductase; Reviewed 100.0
PRK06487 317 glycerate dehydrogenase; Provisional 100.0
PRK06932 314 glycerate dehydrogenase; Provisional 100.0
KOG0068 406 consensus D-3-phosphoglycerate dehydrogenase, D-is 100.0
PLN03139 386 formate dehydrogenase; Provisional 100.0
TIGR01327 525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 100.0
PRK07574 385 formate dehydrogenase; Provisional 100.0
PRK13581 526 D-3-phosphoglycerate dehydrogenase; Provisional 100.0
PRK08605 332 D-lactate dehydrogenase; Validated 100.0
PLN02928 347 oxidoreductase family protein 100.0
PRK12480 330 D-lactate dehydrogenase; Provisional 100.0
KOG0069 336 consensus Glyoxylate/hydroxypyruvate reductase (D- 100.0
PRK15438 378 erythronate-4-phosphate dehydrogenase PdxB; Provis 100.0
PRK06436 303 glycerate dehydrogenase; Provisional 99.98
PRK00257 381 erythronate-4-phosphate dehydrogenase; Validated 99.98
PRK15469 312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 99.97
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 99.86
KOG0067 435 consensus Transcription factor CtBP [Transcription 99.8
PF00389133 2-Hacid_dh: D-isomer specific 2-hydroxyacid dehydr 99.78
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 99.77
PRK08306296 dipicolinate synthase subunit A; Reviewed 99.59
PTZ00075 476 Adenosylhomocysteinase; Provisional 99.55
PRK13403 335 ketol-acid reductoisomerase; Provisional 99.09
PRK05476 425 S-adenosyl-L-homocysteine hydrolase; Provisional 98.88
TIGR00936 406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 98.78
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 98.76
PLN02494 477 adenosylhomocysteinase 98.74
PRK05479 330 ketol-acid reductoisomerase; Provisional 98.56
cd00401 413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 98.52
TIGR00465 314 ilvC ketol-acid reductoisomerase. This is the seco 98.47
cd01075 200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 98.39
PLN02712 667 arogenate dehydrogenase 98.39
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.38
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 98.37
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.3
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.27
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 98.24
PLN02256 304 arogenate dehydrogenase 98.21
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 98.14
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.11
TIGR01505 291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 98.08
TIGR00561 511 pntA NAD(P) transhydrogenase, alpha subunit. In so 98.08
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.07
PRK11559 296 garR tartronate semialdehyde reductase; Provisiona 98.06
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.05
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.05
PLN02712 667 arogenate dehydrogenase 98.03
PRK13302 271 putative L-aspartate dehydrogenase; Provisional 97.98
PF07991165 IlvN: Acetohydroxy acid isomeroreductase, catalyti 97.97
PRK15461 296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 97.91
PRK06545 359 prephenate dehydrogenase; Validated 97.9
PRK07679 279 pyrroline-5-carboxylate reductase; Reviewed 97.87
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.86
PRK12490 299 6-phosphogluconate dehydrogenase-like protein; Rev 97.84
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 97.82
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.82
PRK05225 487 ketol-acid reductoisomerase; Validated 97.8
PRK07417 279 arogenate dehydrogenase; Reviewed 97.77
PRK07502 307 cyclohexadienyl dehydrogenase; Validated 97.76
PRK12491 272 pyrroline-5-carboxylate reductase; Reviewed 97.73
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 97.72
TIGR01035 417 hemA glutamyl-tRNA reductase. This enzyme, togethe 97.72
COG0499 420 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme me 97.72
PRK15059 292 tartronate semialdehyde reductase; Provisional 97.7
TIGR00518 370 alaDH alanine dehydrogenase. The family of known L 97.7
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 97.7
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 97.7
PRK09599 301 6-phosphogluconate dehydrogenase-like protein; Rev 97.68
PRK11880 267 pyrroline-5-carboxylate reductase; Reviewed 97.67
PRK11199 374 tyrA bifunctional chorismate mutase/prephenate deh 97.65
PLN02688 266 pyrroline-5-carboxylate reductase 97.64
PLN02545 295 3-hydroxybutyryl-CoA dehydrogenase 97.64
PRK14170284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.61
COG2084 286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 97.61
PRK14178279 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.61
PRK14169282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.58
PRK06928 277 pyrroline-5-carboxylate reductase; Reviewed 97.58
COG2085 211 Predicted dinucleotide-binding enzymes [General fu 97.58
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 97.57
PRK07066 321 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.55
PRK14183281 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.54
PRK07634 245 pyrroline-5-carboxylate reductase; Reviewed 97.54
PRK14173287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.51
PRK14186297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.51
PRK14172278 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.51
PRK00045 423 hemA glutamyl-tRNA reductase; Reviewed 97.5
PRK08655 437 prephenate dehydrogenase; Provisional 97.49
PLN00203 519 glutamyl-tRNA reductase 97.48
TIGR00872 298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 97.47
PRK13304 265 L-aspartate dehydrogenase; Reviewed 97.47
PLN02858 1378 fructose-bisphosphate aldolase 97.46
KOG1370 434 consensus S-adenosylhomocysteine hydrolase [Coenzy 97.45
PRK06476 258 pyrroline-5-carboxylate reductase; Reviewed 97.44
PRK06130 311 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.43
PRK05472213 redox-sensing transcriptional repressor Rex; Provi 97.43
PRK07680 273 late competence protein ComER; Validated 97.41
PRK14177284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.4
cd01076 227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 97.38
PRK08507 275 prephenate dehydrogenase; Validated 97.37
COG0287 279 TyrA Prephenate dehydrogenase [Amino acid transpor 97.37
TIGR01921 324 DAP-DH diaminopimelate dehydrogenase. This model r 97.37
PRK14167297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.34
PLN02516299 methylenetetrahydrofolate dehydrogenase (NADP+) 97.34
PRK09260 288 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.34
PRK06129 308 3-hydroxyacyl-CoA dehydrogenase; Validated 97.33
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 97.32
COG0345 266 ProC Pyrroline-5-carboxylate reductase [Amino acid 97.32
PRK14618 328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 97.32
PRK14193284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.31
TIGR01692 288 HIBADH 3-hydroxyisobutyrate dehydrogenase. This en 97.3
PRK00094 325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 97.3
PRK14806 735 bifunctional cyclohexadienyl dehydrogenase/ 3-phos 97.3
PRK14171288 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.29
PRK06718 202 precorrin-2 dehydrogenase; Reviewed 97.28
PRK14182282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.27
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 97.27
PLN02616364 tetrahydrofolate dehydrogenase/cyclohydrolase, put 97.27
PRK14185293 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.26
PRK14190284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.25
PTZ00431 260 pyrroline carboxylate reductase; Provisional 97.25
COG0026 375 PurK Phosphoribosylaminoimidazole carboxylase (NCA 97.25
PRK01710 458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.23
COG0373 414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 97.23
PRK14181287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.23
KOG0409 327 consensus Predicted dehydrogenase [General functio 97.22
PRK14187294 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.21
PLN02858 1378 fructose-bisphosphate aldolase 97.21
PLN02897345 tetrahydrofolate dehydrogenase/cyclohydrolase, put 97.21
PRK07340 304 ornithine cyclodeaminase; Validated 97.21
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 97.18
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 97.18
TIGR01546 333 GAPDH-II_archae glyceraldehyde-3-phosphate dehydro 97.17
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 97.17
PRK08618 325 ornithine cyclodeaminase; Validated 97.17
PRK13940 414 glutamyl-tRNA reductase; Provisional 97.17
PRK06141 314 ornithine cyclodeaminase; Validated 97.16
PRK14168297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.16
PRK14184286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.14
PRK14166282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.13
TIGR01470 205 cysG_Nterm siroheme synthase, N-terminal domain. T 97.13
COG0190283 FolD 5,10-methylene-tetrahydrofolate dehydrogenase 97.13
PRK14180282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.12
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 97.11
TIGR03026 411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 97.1
PRK12548289 shikimate 5-dehydrogenase; Provisional 97.1
PTZ00142 470 6-phosphogluconate dehydrogenase; Provisional 97.08
PRK05808 282 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.08
KOG2380 480 consensus Prephenate dehydrogenase (NADP+) [Amino 97.08
PRK13301 267 putative L-aspartate dehydrogenase; Provisional 97.07
TIGR02371 325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 97.05
PRK12549284 shikimate 5-dehydrogenase; Reviewed 97.05
PRK11064 415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 97.05
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 97.04
PRK07530 292 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.04
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 97.03
PRK08293 287 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.03
TIGR01915 219 npdG NADPH-dependent F420 reductase. This model re 97.01
COG1712 255 Predicted dinucleotide-utilizing enzyme [General f 97.01
PRK14174295 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.0
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 97.0
KOG0023 360 consensus Alcohol dehydrogenase, class V [Secondar 96.98
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 96.96
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.96
PRK14982 340 acyl-ACP reductase; Provisional 96.95
PLN02350 493 phosphogluconate dehydrogenase (decarboxylating) 96.94
PRK06407 301 ornithine cyclodeaminase; Provisional 96.92
TIGR02992 326 ectoine_eutC ectoine utilization protein EutC. Mem 96.91
PRK06719157 precorrin-2 dehydrogenase; Validated 96.91
PF02423 313 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-cryst 96.91
PRK07819 286 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.91
PRK06019 372 phosphoribosylaminoimidazole carboxylase ATPase su 96.9
PRK08291 330 ectoine utilization protein EutC; Validated 96.81
TIGR00873 467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 96.79
PRK06035 291 3-hydroxyacyl-CoA dehydrogenase; Validated 96.76
COG0059 338 IlvC Ketol-acid reductoisomerase [Amino acid trans 96.76
PRK06823 315 ornithine cyclodeaminase; Validated 96.72
TIGR02356 202 adenyl_thiF thiazole biosynthesis adenylyltransfer 96.72
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 96.71
PRK07589 346 ornithine cyclodeaminase; Validated 96.69
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 96.69
PRK00676338 hemA glutamyl-tRNA reductase; Validated 96.69
PRK06522 304 2-dehydropantoate 2-reductase; Reviewed 96.68
PF03721 185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 96.67
PRK03369 488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.67
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 96.64
PF03435 386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 96.63
PLN02477 410 glutamate dehydrogenase 96.61
PRK00048 257 dihydrodipicolinate reductase; Provisional 96.6
PRK12921 305 2-dehydropantoate 2-reductase; Provisional 96.6
PRK15057 388 UDP-glucose 6-dehydrogenase; Provisional 96.58
cd05211 217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 96.56
PRK04207 341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 96.54
cd05313 254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutama 96.52
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 96.51
PRK00066 315 ldh L-lactate dehydrogenase; Reviewed 96.5
PRK08229 341 2-dehydropantoate 2-reductase; Provisional 96.47
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 96.42
PTZ00117 319 malate dehydrogenase; Provisional 96.38
PRK04284332 ornithine carbamoyltransferase; Provisional 96.37
COG2423 330 Predicted ornithine cyclodeaminase, mu-crystallin 96.37
PRK12475 338 thiamine/molybdopterin biosynthesis MoeB-like prot 96.35
PRK06046 326 alanine dehydrogenase; Validated 96.34
PRK14619 308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 96.33
PF00185158 OTCace: Aspartate/ornithine carbamoyltransferase, 96.32
PRK08268 507 3-hydroxy-acyl-CoA dehydrogenase; Validated 96.31
PRK02102331 ornithine carbamoyltransferase; Validated 96.31
PRK15182 425 Vi polysaccharide biosynthesis protein TviB; Provi 96.28
PRK03515 336 ornithine carbamoyltransferase subunit I; Provisio 96.27
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 96.22
COG0771 448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas 96.22
PTZ00082 321 L-lactate dehydrogenase; Provisional 96.21
TIGR03376 342 glycerol3P_DH glycerol-3-phosphate dehydrogenase ( 96.21
PRK12562 334 ornithine carbamoyltransferase subunit F; Provisio 96.21
PRK02472 447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.2
PRK08762 376 molybdopterin biosynthesis protein MoeB; Validated 96.19
PRK14031 444 glutamate dehydrogenase; Provisional 96.18
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 96.18
TIGR03316 357 ygeW probable carbamoyltransferase YgeW. Members o 96.17
TIGR02279 503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 96.16
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 96.14
PRK13303 265 L-aspartate dehydrogenase; Provisional 96.12
PRK00779304 ornithine carbamoyltransferase; Provisional 96.11
PRK02006 498 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.11
PRK04690 468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.08
PRK00141 473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.08
PRK09414 445 glutamate dehydrogenase; Provisional 96.07
PRK06249 313 2-dehydropantoate 2-reductase; Provisional 96.05
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 96.05
PLN02353 473 probable UDP-glucose 6-dehydrogenase 96.04
TIGR00658304 orni_carb_tr ornithine carbamoyltransferase. Most 96.04
PRK04523335 N-acetylornithine carbamoyltransferase; Reviewed 96.04
PRK06223 307 malate dehydrogenase; Reviewed 96.03
PRK01713 334 ornithine carbamoyltransferase; Provisional 96.03
cd05311 226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 96.02
TIGR00670301 asp_carb_tr aspartate carbamoyltransferase. Ornith 95.99
PRK00421 461 murC UDP-N-acetylmuramate--L-alanine ligase; Provi 95.99
PRK14620 326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 95.98
PRK06199 379 ornithine cyclodeaminase; Validated 95.96
TIGR01161 352 purK phosphoribosylaminoimidazole carboxylase, Pur 95.91
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene- 95.87
PRK11891 429 aspartate carbamoyltransferase; Provisional 95.85
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.81
PLN02948 577 phosphoribosylaminoimidazole carboxylase 95.8
PF00044151 Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, 95.8
COG0569 225 TrkA K+ transport systems, NAD-binding component [ 95.79
PRK12439 341 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 95.77
PF13460 183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 95.76
TIGR01763 305 MalateDH_bact malate dehydrogenase, NAD-dependent. 95.73
PRK00683 418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.72
PRK05562 223 precorrin-2 dehydrogenase; Provisional 95.64
PRK07688 339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 95.62
PRK11579 346 putative oxidoreductase; Provisional 95.61
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 95.58
PRK01390 460 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.57
cd05291 306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 95.56
TIGR00036 266 dapB dihydrodipicolinate reductase. 95.53
COG0057 335 GapA Glyceraldehyde-3-phosphate dehydrogenase/eryt 95.51
PTZ00345 365 glycerol-3-phosphate dehydrogenase; Provisional 95.51
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 95.48
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 95.47
COG1648 210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 95.46
PRK04308 445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.45
PRK09496 453 trkA potassium transporter peripheral membrane com 95.43
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 95.42
PLN02527306 aspartate carbamoyltransferase 95.36
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 95.35
PRK07806 248 short chain dehydrogenase; Provisional 95.35
PRK14030 445 glutamate dehydrogenase; Provisional 95.35
PRK03803 448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.34
cd00757 228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 95.33
cd01339 300 LDH-like_MDH L-lactate dehydrogenase-like malate d 95.32
PRK02255 338 putrescine carbamoyltransferase; Provisional 95.31
PRK08818 370 prephenate dehydrogenase; Provisional 95.26
PRK08644 212 thiamine biosynthesis protein ThiF; Provisional 95.25
PRK01368 454 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.23
PRK06114 254 short chain dehydrogenase; Provisional 95.21
cd05293 312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 95.17
COG0240 329 GpsA Glycerol-3-phosphate dehydrogenase [Energy pr 95.17
PRK07576 264 short chain dehydrogenase; Provisional 95.12
COG0673 342 MviM Predicted dehydrogenases and related proteins 95.05
PLN02272 421 glyceraldehyde-3-phosphate dehydrogenase 95.05
cd00650 263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 95.04
cd05292 308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 95.02
PRK07523 255 gluconate 5-dehydrogenase; Provisional 95.02
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 95.01
COG0540316 PyrB Aspartate carbamoyltransferase, catalytic cha 94.93
cd05297 423 GH4_alpha_glucosidase_galactosidase Glycoside Hydr 94.91
PRK08217 253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.89
PLN02214 342 cinnamoyl-CoA reductase 94.89
COG1023 300 Gnd Predicted 6-phosphogluconate dehydrogenase [Ca 94.89
PRK07326 237 short chain dehydrogenase; Provisional 94.87
PF05368 233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 94.87
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 94.87
PRK07200 395 aspartate/ornithine carbamoyltransferase family pr 94.86
PF04016147 DUF364: Domain of unknown function (DUF364); Inter 94.85
TIGR02964246 xanthine_xdhC xanthine dehydrogenase accessory pro 94.82
TIGR01832 248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 94.79
PRK12826 251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 94.78
PRK06172 253 short chain dehydrogenase; Provisional 94.78
PLN02602 350 lactate dehydrogenase 94.76
PTZ00079 454 NADP-specific glutamate dehydrogenase; Provisional 94.75
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 94.74
PLN00106 323 malate dehydrogenase 94.74
PRK06949 258 short chain dehydrogenase; Provisional 94.73
PRK10637 457 cysG siroheme synthase; Provisional 94.62
COG0334 411 GdhA Glutamate dehydrogenase/leucine dehydrogenase 94.58
PF00208 244 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Val 94.55
cd01483143 E1_enzyme_family Superfamily of activating enzymes 94.54
PRK08589 272 short chain dehydrogenase; Validated 94.51
TIGR01532 325 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenas 94.51
PRK03806 438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.48
PRK07231 251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.48
TIGR01087 433 murD UDP-N-acetylmuramoylalanine--D-glutamate liga 94.46
PLN02342348 ornithine carbamoyltransferase 94.44
PRK05866 293 short chain dehydrogenase; Provisional 94.42
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 94.41
PLN03209 576 translocon at the inner envelope of chloroplast su 94.39
PRK07890 258 short chain dehydrogenase; Provisional 94.39
PF03720106 UDPG_MGDP_dh_C: UDP-glucose/GDP-mannose dehydrogen 94.37
PRK07533 258 enoyl-(acyl carrier protein) reductase; Provisiona 94.36
PRK09189240 uroporphyrinogen-III synthase; Validated 94.35
PRK12937 245 short chain dehydrogenase; Provisional 94.32
PRK05600 370 thiamine biosynthesis protein ThiF; Validated 94.31
PRK14804311 ornithine carbamoyltransferase; Provisional 94.3
PRK05867 253 short chain dehydrogenase; Provisional 94.3
PTZ00325 321 malate dehydrogenase; Provisional 94.26
PRK05708 305 2-dehydropantoate 2-reductase; Provisional 94.25
PRK05786 238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.24
COG0677 436 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenas 94.22
PRK08300 302 acetaldehyde dehydrogenase; Validated 94.21
TIGR01761 343 thiaz-red thiazolinyl imide reductase. This reduct 94.21
PRK08628 258 short chain dehydrogenase; Provisional 94.2
PRK00856305 pyrB aspartate carbamoyltransferase catalytic subu 94.19
PRK12935 247 acetoacetyl-CoA reductase; Provisional 94.16
PRK14027283 quinate/shikimate dehydrogenase; Provisional 94.14
PRK05086 312 malate dehydrogenase; Provisional 94.11
PRK05876 275 short chain dehydrogenase; Provisional 94.1
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 94.04
PF13478136 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2 94.03
cd05290 307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 93.98
PRK06523 260 short chain dehydrogenase; Provisional 93.98
PRK08416 260 7-alpha-hydroxysteroid dehydrogenase; Provisional 93.97
PRK07424 406 bifunctional sterol desaturase/short chain dehydro 93.93
PRK06701 290 short chain dehydrogenase; Provisional 93.92
PRK12939 250 short chain dehydrogenase; Provisional 93.9
PRK06057 255 short chain dehydrogenase; Provisional 93.89
PRK02705 459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.89
COG2344211 AT-rich DNA-binding protein [General function pred 93.85
PRK12367 245 short chain dehydrogenase; Provisional 93.8
PRK07239 381 bifunctional uroporphyrinogen-III synthetase/respo 93.79
TIGR02440 699 FadJ fatty oxidation complex, alpha subunit FadJ. 93.78
cd01336 325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 93.78
PRK05690 245 molybdopterin biosynthesis protein MoeB; Provision 93.76
PRK12938 246 acetyacetyl-CoA reductase; Provisional 93.74
PRK08192 338 aspartate carbamoyltransferase; Provisional 93.72
PRK09186 256 flagellin modification protein A; Provisional 93.72
PRK07792 306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 93.71
PRK06270 341 homoserine dehydrogenase; Provisional 93.66
PRK07370 258 enoyl-(acyl carrier protein) reductase; Validated 93.56
PRK06935 258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 93.56
PRK07478 254 short chain dehydrogenase; Provisional 93.55
CHL00194 317 ycf39 Ycf39; Provisional 93.55
TIGR03215 285 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylati 93.54
PRK15076 431 alpha-galactosidase; Provisional 93.54
PRK08862 227 short chain dehydrogenase; Provisional 93.53
PRK07984 262 enoyl-(acyl carrier protein) reductase; Provisiona 93.52
PRK04148134 hypothetical protein; Provisional 93.48
PRK07035 252 short chain dehydrogenase; Provisional 93.42
TIGR03206 250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 93.41
cd00300 300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 93.37
PRK13394 262 3-hydroxybutyrate dehydrogenase; Provisional 93.36
PLN02353473 probable UDP-glucose 6-dehydrogenase 93.35
PRK06124 256 gluconate 5-dehydrogenase; Provisional 93.31
PLN02206 442 UDP-glucuronate decarboxylase 93.28
PRK07774 250 short chain dehydrogenase; Provisional 93.27
PF03447117 NAD_binding_3: Homoserine dehydrogenase, NAD bindi 93.25
PRK15181 348 Vi polysaccharide biosynthesis protein TviC; Provi 93.24
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 93.23
TIGR01142 380 purT phosphoribosylglycinamide formyltransferase 2 93.22
PRK08085 254 gluconate 5-dehydrogenase; Provisional 93.22
PRK06194 287 hypothetical protein; Provisional 93.19
PRK08339 263 short chain dehydrogenase; Provisional 93.17
PRK13814310 pyrB aspartate carbamoyltransferase catalytic subu 93.16
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 93.16
PRK05872 296 short chain dehydrogenase; Provisional 93.15
COG0686 371 Ald Alanine dehydrogenase [Amino acid transport an 93.14
KOG0022 375 consensus Alcohol dehydrogenase, class III [Second 93.13
PLN02427 386 UDP-apiose/xylose synthase 93.12
PF0262996 CoA_binding: CoA binding domain; InterPro: IPR0037 93.12
smart00846149 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, 93.12
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 93.09
PRK08936 261 glucose-1-dehydrogenase; Provisional 93.09
PRK12742 237 oxidoreductase; Provisional 93.09
PRK06125 259 short chain dehydrogenase; Provisional 93.06
PRK12429 258 3-hydroxybutyrate dehydrogenase; Provisional 93.05
COG1893 307 ApbA Ketopantoate reductase [Coenzyme metabolism] 93.04
PRK06603 260 enoyl-(acyl carrier protein) reductase; Provisiona 93.04
PRK15057388 UDP-glucose 6-dehydrogenase; Provisional 93.02
PRK11154 708 fadJ multifunctional fatty acid oxidation complex 93.02
PRK08415 274 enoyl-(acyl carrier protein) reductase; Provisiona 93.02
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 92.98
TIGR01759 323 MalateDH-SF1 malate dehydrogenase. This model repr 92.98
PRK05565 247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 92.98
PLN02662 322 cinnamyl-alcohol dehydrogenase family protein 92.94
cd05312 279 NAD_bind_1_malic_enz NAD(P) binding domain of mali 92.92
TIGR01850 346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 92.9
PLN02896 353 cinnamyl-alcohol dehydrogenase 92.9
PRK07889 256 enoyl-(acyl carrier protein) reductase; Provisiona 92.87
TIGR02441 737 fa_ox_alpha_mit fatty acid oxidation complex, alph 92.87
PRK07060 245 short chain dehydrogenase; Provisional 92.84
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 92.83
PRK07666 239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 92.83
PF13380116 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5 92.83
cd05294 309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 92.8
PRK08159 272 enoyl-(acyl carrier protein) reductase; Provisiona 92.8
PRK06398 258 aldose dehydrogenase; Validated 92.8
PRK08690 261 enoyl-(acyl carrier protein) reductase; Provisiona 92.79
PRK08303 305 short chain dehydrogenase; Provisional 92.76
PRK06079 252 enoyl-(acyl carrier protein) reductase; Provisiona 92.71
PRK06997 260 enoyl-(acyl carrier protein) reductase; Provisiona 92.71
PRK12481 251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 92.69
PLN02695 370 GDP-D-mannose-3',5'-epimerase 92.66
PRK03659 601 glutathione-regulated potassium-efflux system prot 92.65
PRK11730 715 fadB multifunctional fatty acid oxidation complex 92.62
TIGR02437 714 FadB fatty oxidation complex, alpha subunit FadB. 92.56
PRK07454 241 short chain dehydrogenase; Provisional 92.56
PRK05557 248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 92.55
PRK04663 438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.55
PRK06139 330 short chain dehydrogenase; Provisional 92.54
PRK05928249 hemD uroporphyrinogen-III synthase; Reviewed 92.53
PRK07825 273 short chain dehydrogenase; Provisional 92.53
PRK06505 271 enoyl-(acyl carrier protein) reductase; Provisiona 92.51
PRK10206 344 putative oxidoreductase; Provisional 92.51
PRK08277 278 D-mannonate oxidoreductase; Provisional 92.5
TIGR01758 324 MDH_euk_cyt malate dehydrogenase, NAD-dependent. T 92.49
PRK06196 315 oxidoreductase; Provisional 92.49
PRK09880343 L-idonate 5-dehydrogenase; Provisional 92.45
PRK07856 252 short chain dehydrogenase; Provisional 92.43
PRK12825 249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 92.41
PRK05875 276 short chain dehydrogenase; Provisional 92.38
PLN02657 390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 92.36
PRK06182 273 short chain dehydrogenase; Validated 92.35
PRK08213 259 gluconate 5-dehydrogenase; Provisional 92.34
cd00704 323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 92.34
PRK14573 809 bifunctional D-alanyl-alanine synthetase A/UDP-N-a 92.32
PRK08642 253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 92.31
PRK06198 260 short chain dehydrogenase; Provisional 92.22
PRK12745 256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 92.21
PRK07814 263 short chain dehydrogenase; Provisional 92.19
PRK09291 257 short chain dehydrogenase; Provisional 92.14
cd01338 322 MDH_choloroplast_like Chloroplast-like malate dehy 92.14
PRK08324 681 short chain dehydrogenase; Validated 92.11
PRK06138 252 short chain dehydrogenase; Provisional 92.11
PRK08177 225 short chain dehydrogenase; Provisional 92.11
TIGR02622 349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 92.1
PRK12823 260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 92.08
TIGR03649 285 ergot_EASG ergot alkaloid biosynthesis protein, AF 92.01
PRK09496 453 trkA potassium transporter peripheral membrane com 91.98
PRK14805302 ornithine carbamoyltransferase; Provisional 91.97
PRK12859 256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 91.95
PRK09242 257 tropinone reductase; Provisional 91.87
PRK12748 256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 91.85
PRK07102 243 short chain dehydrogenase; Provisional 91.84
PRK03562 621 glutathione-regulated potassium-efflux system prot 91.83
PRK06392 326 homoserine dehydrogenase; Provisional 91.82
PRK06128 300 oxidoreductase; Provisional 91.78
PLN02989 325 cinnamyl-alcohol dehydrogenase family protein 91.78
PRK08063 250 enoyl-(acyl carrier protein) reductase; Provisiona 91.72
PRK07453 322 protochlorophyllide oxidoreductase; Validated 91.71
PRK12828 239 short chain dehydrogenase; Provisional 91.69
PRK06171 266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 91.69
TIGR01772 312 MDH_euk_gproteo malate dehydrogenase, NAD-dependen 91.68
PRK09987 299 dTDP-4-dehydrorhamnose reductase; Provisional 91.67
PRK06349 426 homoserine dehydrogenase; Provisional 91.67
PRK06181 263 short chain dehydrogenase; Provisional 91.67
PRK05653 246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 91.66
TIGR01829 242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 91.64
PRK08226 263 short chain dehydrogenase; Provisional 91.64
PRK06841 255 short chain dehydrogenase; Provisional 91.61
PRK00436 343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 91.6
PLN02240 352 UDP-glucose 4-epimerase 91.59
PLN00198 338 anthocyanidin reductase; Provisional 91.54
PRK09288 395 purT phosphoribosylglycinamide formyltransferase 2 91.53
PRK08703 239 short chain dehydrogenase; Provisional 91.51
COG0565 242 LasT rRNA methylase [Translation, ribosomal struct 91.5
PRK06463 255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 91.49
PRK06197 306 short chain dehydrogenase; Provisional 91.41
PRK07063 260 short chain dehydrogenase; Provisional 91.33
PRK08278 273 short chain dehydrogenase; Provisional 91.31
PRK06940 275 short chain dehydrogenase; Provisional 91.29
PRK07097 265 gluconate 5-dehydrogenase; Provisional 91.24
PRK08993 253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 91.1
PRK09135 249 pteridine reductase; Provisional 91.07
TIGR03589 324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 91.06
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
Probab=100.00  E-value=1.6e-44  Score=324.56  Aligned_cols=244  Identities=93%  Similarity=1.414  Sum_probs=196.0

Q ss_pred             CCCceeeeeeCCCCCeEEEEeCCCCchHHHHHHHhCCCeEEEeccCCCCCCHHHHHHHhcCCccEEEeccCccccHHHHH
Q 026023            1 MAKPVSIEVWNPNGKYRVVSTKPMPGTRWINLLIEQDCRVEICTQKKTILSVEDIIALIGDKCDGVIGQLTEDWGETLFA   80 (244)
Q Consensus         1 ~~~~~~~~~~~~~~~~~ilv~~~~~~~~~~~~l~~~~~~v~~~~~~~~~~~~~~~~~~~~~~ad~ii~~~~~~~~~~~l~   80 (244)
                      |.||+.+.+-+|.++++|+++.++++....+.|++.+++++.....+...+.+++.+.+.+++|++++....++++++++
T Consensus         1 ~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~L~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~d~vi~~~~~~i~~~~l~   80 (386)
T PLN02306          1 MAKPVSIEVYNPNGKYRVVSTKPMPGTRWINLLVDQDCRVEICTEKKTILSVEDIIALIGDKCDGVIGQLTEDWGETLFS   80 (386)
T ss_pred             CCCCceeEeeCCCCCceEEEeCCCCcHHHHHHHHhcCceEEecCCcCCCCCHHHHHHHhhcCCcEEEEcCCCCcCHHHHH
Confidence            89999999999999999999998876334677776666776443223336888999887545999998766789999999


Q ss_pred             HhhccCCcEEEEcccCCCccChHHHhhCCcEEEecCCCCCcchHHHHHHHHHHHHhChHHHHHHHHcCCCCCCCCCcccc
Q 026023           81 ALSRAGGKAFSNMAVGYNNVDVNAANKYGIAVGNTPGVLTETTAELAASLSLAAARRIVEADEFMRAGLYDGWLPNLFVG  160 (244)
Q Consensus        81 ~~p~l~~k~I~~~~aG~d~id~~~~~~~gI~v~n~~~~~~~~vAE~~l~~~L~~~R~~~~~~~~~~~~~w~~~~~~~~~~  160 (244)
                      ++|++++|+|++.|+|+||||.+++.++||.|+|++|+++.+||||++++||++.|++..+++.+++|.|.+|.+....+
T Consensus        81 ~~~~l~lk~I~~~~~G~D~iD~~aa~~~gI~V~n~pg~~~~~VAE~al~liLal~R~i~~~~~~~~~g~w~~~~~~~~~g  160 (386)
T PLN02306         81 ALSKAGGKAFSNMAVGYNNVDVEAANKYGIAVGNTPGVLTETTAELAASLSLAAARRIVEADEFMRAGLYEGWLPHLFVG  160 (386)
T ss_pred             hCCcCCceEEEECCcccccccHHHHHHCCCEEEECCCcCHHHHHHHHHHHHHHHHhChHHHHHHHHcCCCccccccccCC
Confidence            99976669999999999999999999999999999999999999999999999999999999999999998786543456


Q ss_pred             cccCCCEEEEEcCChHHHHHHHHHhccCCcEEEEEcCCcchHHHHHHhhhhhhhhcCCCCCccccccCCHHHHhhhCCEE
Q 026023          161 NLLKGQTVGVIGAGRIGSAYARMMVEGFKMNLIYYDLYQATRLEKFVTAYGQFLKANGEQPVTWKRASSMDEVLREADVV  240 (244)
Q Consensus       161 ~~l~g~tvgIvG~G~IG~~vA~~la~afG~~V~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~ell~~sD~V  240 (244)
                      .+|.|+||||+|+|+||+++|++++++|||+|++|||+++...+.+...+|.-....+.....+....+|+|+|++||+|
T Consensus       161 ~~L~gktvGIiG~G~IG~~vA~~l~~~fGm~V~~~d~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~L~ell~~sDiV  240 (386)
T PLN02306        161 NLLKGQTVGVIGAGRIGSAYARMMVEGFKMNLIYYDLYQSTRLEKFVTAYGQFLKANGEQPVTWKRASSMEEVLREADVI  240 (386)
T ss_pred             cCCCCCEEEEECCCHHHHHHHHHHHhcCCCEEEEECCCCchhhhhhhhhhcccccccccccccccccCCHHHHHhhCCEE
Confidence            78999999999999999999999624999999999998754322211122111111111111222346899999999999


Q ss_pred             EEeC
Q 026023          241 CTLC  244 (244)
Q Consensus       241 vl~~  244 (244)
                      ++||
T Consensus       241 ~lh~  244 (386)
T PLN02306        241 SLHP  244 (386)
T ss_pred             EEeC
Confidence            9997



>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>KOG0068 consensus D-3-phosphoglycerate dehydrogenase, D-isomer-specific 2-hydroxy acid dehydrogenase superfamily [Amino acid transport and metabolism] Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion] Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>KOG0067 consensus Transcription factor CtBP [Transcription] Back     alignment and domain information
>PF00389 2-Hacid_dh: D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain; InterPro: IPR006139 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK05225 ketol-acid reductoisomerase; Validated Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism] Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>KOG1370 consensus S-adenosylhomocysteine hydrolase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK05472 redox-sensing transcriptional repressor Rex; Provisional Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase Back     alignment and domain information
>PRK14167 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+) Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PLN02616 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PRK14185 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PTZ00431 pyrroline carboxylate reductase; Provisional Back     alignment and domain information
>COG0026 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK14181 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>KOG0409 consensus Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PLN02897 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK14168 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14184 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] Back     alignment and domain information
>PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>KOG2380 consensus Prephenate dehydrogenase (NADP+) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>PRK14174 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>KOG0023 consensus Alcohol dehydrogenase, class V [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK06407 ornithine cyclodeaminase; Provisional Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PF02423 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-crystallin family; InterPro: IPR003462 This entry represents the bacterial ornithine cyclodeaminase enzyme family, which catalyse the deamination of ornithine to proline [] Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG0059 IlvC Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK06823 ornithine cyclodeaminase; Validated Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK07589 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>PRK00676 hemA glutamyl-tRNA reductase; Validated Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PLN02477 glutamate dehydrogenase Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK04284 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>COG2423 Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK06046 alanine dehydrogenase; Validated Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PF00185 OTCace: Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain; InterPro: IPR006131 This family contains two related enzymes: Aspartate carbamoyltransferase (2 Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK02102 ornithine carbamoyltransferase; Validated Back     alignment and domain information
>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional Back     alignment and domain information
>PRK03515 ornithine carbamoyltransferase subunit I; Provisional Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information
>PRK12562 ornithine carbamoyltransferase subunit F; Provisional Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK14031 glutamate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>TIGR03316 ygeW probable carbamoyltransferase YgeW Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK00779 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK09414 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>TIGR00658 orni_carb_tr ornithine carbamoyltransferase Back     alignment and domain information
>PRK04523 N-acetylornithine carbamoyltransferase; Reviewed Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PRK01713 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>TIGR00670 asp_carb_tr aspartate carbamoyltransferase Back     alignment and domain information
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06199 ornithine cyclodeaminase; Validated Back     alignment and domain information
>TIGR01161 purK phosphoribosylaminoimidazole carboxylase, PurK protein Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>PRK11891 aspartate carbamoyltransferase; Provisional Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN02948 phosphoribosylaminoimidazole carboxylase Back     alignment and domain information
>PF00044 Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; InterPro: IPR020828 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) plays an important role in glycolysis and gluconeogenesis [] by reversibly catalysing the oxidation and phosphorylation of D-glyceraldehyde-3-phosphate to 1,3-diphospho-glycerate Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>COG0057 GapA Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PLN02527 aspartate carbamoyltransferase Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14030 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>PRK02255 putrescine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>PLN02272 glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>COG0540 PyrB Aspartate carbamoyltransferase, catalytic chain [Nucleotide transport and metabolism] Back     alignment and domain information
>cd05297 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>PRK07200 aspartate/ornithine carbamoyltransferase family protein; Validated Back     alignment and domain information
>PF04016 DUF364: Domain of unknown function (DUF364); InterPro: IPR007161 This is a entry represents of bacterial and archaeal proteins of unknown function Back     alignment and domain information
>TIGR02964 xanthine_xdhC xanthine dehydrogenase accessory protein XdhC Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>PTZ00079 NADP-specific glutamate dehydrogenase; Provisional Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10637 cysG siroheme synthase; Provisional Back     alignment and domain information
>COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF00208 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Valine dehydrogenase; InterPro: IPR006096 Glutamate, leucine, phenylalanine and valine dehydrogenases are structurally and functionally related Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR01532 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenase Back     alignment and domain information
>PRK03806 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR01087 murD UDP-N-acetylmuramoylalanine--D-glutamate ligase Back     alignment and domain information
>PLN02342 ornithine carbamoyltransferase Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF03720 UDPG_MGDP_dh_C: UDP-glucose/GDP-mannose dehydrogenase family, UDP binding domain; InterPro: IPR014027 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK09189 uroporphyrinogen-III synthase; Validated Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>PRK14804 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>TIGR01761 thiaz-red thiazolinyl imide reductase Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK00856 pyrB aspartate carbamoyltransferase catalytic subunit; Provisional Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>PF13478 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2WE7_A Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG2344 AT-rich DNA-binding protein [General function prediction only] Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07239 bifunctional uroporphyrinogen-III synthetase/response regulator domain protein; Validated Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK08192 aspartate carbamoyltransferase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06270 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>PRK15076 alpha-galactosidase; Provisional Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF03447 NAD_binding_3: Homoserine dehydrogenase, NAD binding domain; InterPro: IPR005106 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>TIGR01142 purT phosphoribosylglycinamide formyltransferase 2 Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13814 pyrB aspartate carbamoyltransferase catalytic subunit; Provisional Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0022 consensus Alcohol dehydrogenase, class III [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PF02629 CoA_binding: CoA binding domain; InterPro: IPR003781 This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases Back     alignment and domain information
>smart00846 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1 Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK04663 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05928 hemD uroporphyrinogen-III synthase; Reviewed Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK10206 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>PRK14573 bifunctional D-alanyl-alanine synthetase A/UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK14805 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>PRK06392 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PRK09288 purT phosphoribosylglycinamide formyltransferase 2; Validated Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0565 LasT rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query244
1gdh_A320 Crystal Structure Of A Nad-Dependent D-Glycerate De 1e-12
2dbr_A 334 Crystal Structure Of Glyoxylate Reductase (Ph0597) 6e-12
4g2n_A345 Crystal Structure Of Putative D-Isomer Specific 2-H 9e-12
2dld_A 337 D-Lactate Dehydrogenase Complexed With Nadh And Oxa 5e-11
2dbq_A 334 Crystal Structure Of Glyoxylate Reductase (Ph0597) 6e-11
2gcg_A330 Ternary Crystal Structure Of Human Glyoxylate Reduc 3e-10
2h1s_A328 Crystal Structure Of A GlyoxylateHYDROXYPYRUVATE RE 1e-09
2g76_A335 Crystal Structure Of Human 3-Phosphoglycerate Dehyd 1e-09
2cuk_A 311 Crystal Structure Of Tt0316 Protein From Thermus Th 2e-09
1j4a_A 333 Insights Into Domain Closure, Substrate Specificity 5e-09
2d0i_A 333 Crystal Structure Ph0520 Protein From Pyrococcus Ho 5e-09
1j49_A 333 Insights Into Domain Closure, Substrate Specificity 5e-09
1hl3_A 358 CtbpBARS IN TERNARY COMPLEX WITH NAD(H) AND PIDLSKK 3e-08
3k5p_A 416 Crystal Structure Of Amino Acid-Binding Act: D-Isom 5e-08
1dxy_A 333 Structure Of D-2-Hydroxyisocaproate Dehydrogenase L 7e-08
1hku_A 358 CtbpBARS: A DUAL-Function Protein Involved In Trans 1e-07
1mx3_A 347 Crystal Structure Of Ctbp Dehydrogenase Core Holo F 1e-07
2yq4_A 343 Crystal Structure Of D-isomer Specific 2-hydroxyaci 2e-07
3ga0_A 358 Ctbp1BARS GLY172->glu Mutant Structure: Impairing N 2e-07
3ddn_A 528 Crystal Structure Of Hydroxypyruvic Acid Phosphate 2e-07
1ygy_A 529 Crystal Structure Of D-3-Phosphoglycerate Dehydroge 3e-07
3ba1_A333 Structure Of Hydroxyphenylpyruvate Reductase From C 4e-07
2ome_A 336 Crystal Structure Of Human Ctbp2 Dehydrogenase Comp 8e-07
4e5n_A 330 Thermostable Phosphite Dehydrogenase In Complex Wit 1e-06
4e5k_A 329 Thermostable Phosphite Dehydrogenase In Complex Wit 2e-06
4ebf_A 334 Semet Thermostable Phosphite Dehydrogenase Glu175-A 2e-06
4e5m_A 329 Thermostable Phosphite Dehydrogenase E175aA176R IN 2e-06
4e5p_A 332 Thermostable Phosphite Dehydrogenase A176r Variant 2e-06
2w2k_A 348 Crystal Structure Of The Apo Forms Of Rhodotorula G 2e-05
2w2k_B 348 Crystal Structure Of The Apo Forms Of Rhodotorula G 2e-05
2w2l_D 348 Crystal Structure Of The Holo Forms Of Rhodotorula 2e-05
1wwk_A 307 Crystal Structure Of Phosphoglycerate Dehydrogenase 6e-05
4dgs_A340 The Crystals Structure Of Dehydrogenase From Rhizob 1e-04
2ekl_A 313 Structure Of St1218 Protein From Sulfolobus Tokodai 3e-04
2p9c_A 410 Crystal Structure Of Serine Bound G336v Mutant Of E 6e-04
2p9g_A 410 Crystal Structure Of Serine Bound G336v,G337v Doubl 6e-04
2j6i_A 364 Candida Boidinii Formate Dehydrogenase (Fdh) C-Term 9e-04
2fss_A 365 Candida Boidinii Formate Dehydrogenase (Fdh) K47e M 9e-04
3kb6_A 334 Crystal Structure Of D-lactate Dehydrogenase From A 9e-04
>pdb|1GDH|A Chain A, Crystal Structure Of A Nad-Dependent D-Glycerate Dehydrogenase At 2.4 Angstroms Resolution Length = 320 Back     alignment and structure

Iteration: 1

Score = 70.1 bits (170), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 45/167 (26%), Positives = 79/167 (47%), Gaps = 15/167 (8%) Query: 36 QDCRVEICTQKKTILSVEDIIALIGDKC-DGVIGQLTEDWGETLFAALSRAGGKAFSNMA 94 D ++ I +T SV+ ++ + +KC VI ++ E+ K S + Sbjct: 29 DDPKITIDEMIETAKSVDALLITLNEKCRKEVIDRIPENI-------------KCISTYS 75 Query: 95 VGYNNVDVNAANKYGIAVGNTPGVXXXXXXXXXXXXXXXXXRRIVEADEFMRAGLYDGWL 154 +G++++D++A GI VGN P RR E ++ +R + GW Sbjct: 76 IGFDHIDLDACKARGIKVGNAPHGVTVATAEIAMLLLLGSARRAGEGEKMIRTRSWPGWE 135 Query: 155 PNLFVGNLLKGQTVGVIGAGRIGSAYARMMVEGFKMNLIYYDLYQAT 201 P VG L +T+G+ G G IG A A+ +GF M++ Y+D ++A+ Sbjct: 136 PLELVGEKLDNKTLGIYGFGSIGQALAK-RAQGFDMDIDYFDTHRAS 181
>pdb|2DBR|A Chain A, Crystal Structure Of Glyoxylate Reductase (Ph0597) From Pyrococcus Horikoshii Ot3, Complexed With Nadp (P1) Length = 334 Back     alignment and structure
>pdb|4G2N|A Chain A, Crystal Structure Of Putative D-Isomer Specific 2-Hydroxyacid Dehydrogenase, Nad-Binding From Polaromonas Sp. Js6 66 Length = 345 Back     alignment and structure
>pdb|2DLD|A Chain A, D-Lactate Dehydrogenase Complexed With Nadh And Oxamate Length = 337 Back     alignment and structure
>pdb|2DBQ|A Chain A, Crystal Structure Of Glyoxylate Reductase (Ph0597) From Pyrococcus Horikoshii Ot3, Complexed With Nadp (I41) Length = 334 Back     alignment and structure
>pdb|2GCG|A Chain A, Ternary Crystal Structure Of Human Glyoxylate ReductaseHYDROXYPYRUVATE REDUCTASE Length = 330 Back     alignment and structure
>pdb|2H1S|A Chain A, Crystal Structure Of A GlyoxylateHYDROXYPYRUVATE REDUCTASE FROM HOMO Sapiens Length = 328 Back     alignment and structure
>pdb|2G76|A Chain A, Crystal Structure Of Human 3-Phosphoglycerate Dehydrogenase Length = 335 Back     alignment and structure
>pdb|2CUK|A Chain A, Crystal Structure Of Tt0316 Protein From Thermus Thermophilus Hb8 Length = 311 Back     alignment and structure
>pdb|1J4A|A Chain A, Insights Into Domain Closure, Substrate Specificity And Catalysis Of D-Lactate Dehydrogenase From Lactobacillus Bulgaricus Length = 333 Back     alignment and structure
>pdb|2D0I|A Chain A, Crystal Structure Ph0520 Protein From Pyrococcus Horikoshii Ot3 Length = 333 Back     alignment and structure
>pdb|1J49|A Chain A, Insights Into Domain Closure, Substrate Specificity And Catalysis Of D-Lactate Dehydrogenase From Lactobacillus Bulgaricus Length = 333 Back     alignment and structure
>pdb|1HL3|A Chain A, CtbpBARS IN TERNARY COMPLEX WITH NAD(H) AND PIDLSKK PEPTIDE Length = 358 Back     alignment and structure
>pdb|3K5P|A Chain A, Crystal Structure Of Amino Acid-Binding Act: D-Isomer Specific 2- Hydroxyacid Dehydrogenase Catalytic Domain From Brucella Melitensis Length = 416 Back     alignment and structure
>pdb|1DXY|A Chain A, Structure Of D-2-Hydroxyisocaproate Dehydrogenase Length = 333 Back     alignment and structure
>pdb|1HKU|A Chain A, CtbpBARS: A DUAL-Function Protein Involved In Transcription Corepression And Golgi Membrane Fission Length = 358 Back     alignment and structure
>pdb|1MX3|A Chain A, Crystal Structure Of Ctbp Dehydrogenase Core Holo Form Length = 347 Back     alignment and structure
>pdb|2YQ4|A Chain A, Crystal Structure Of D-isomer Specific 2-hydroxyacid Dehydrogenase From Lactobacillus Delbrueckii Ssp. Bulgaricus Length = 343 Back     alignment and structure
>pdb|3GA0|A Chain A, Ctbp1BARS GLY172->glu Mutant Structure: Impairing Nad(H) Binding And Dimerization Length = 358 Back     alignment and structure
>pdb|3DDN|A Chain A, Crystal Structure Of Hydroxypyruvic Acid Phosphate Bound D-3- Phosphoglycerate Dehydrogenase In Mycobacterium Tuberculosis Length = 528 Back     alignment and structure
>pdb|1YGY|A Chain A, Crystal Structure Of D-3-Phosphoglycerate Dehydrogenase From Mycobacterium Tuberculosis Length = 529 Back     alignment and structure
>pdb|3BA1|A Chain A, Structure Of Hydroxyphenylpyruvate Reductase From Coleus Blu Length = 333 Back     alignment and structure
>pdb|2OME|A Chain A, Crystal Structure Of Human Ctbp2 Dehydrogenase Complexed With Nad(H) Length = 336 Back     alignment and structure
>pdb|4E5N|A Chain A, Thermostable Phosphite Dehydrogenase In Complex With Nad Length = 330 Back     alignment and structure
>pdb|4E5K|A Chain A, Thermostable Phosphite Dehydrogenase In Complex With Nad And Sulfite Length = 329 Back     alignment and structure
>pdb|4EBF|A Chain A, Semet Thermostable Phosphite Dehydrogenase Glu175-Ala Mutant Length = 334 Back     alignment and structure
>pdb|4E5M|A Chain A, Thermostable Phosphite Dehydrogenase E175aA176R IN COMPLEX WITH NADP Length = 329 Back     alignment and structure
>pdb|4E5P|A Chain A, Thermostable Phosphite Dehydrogenase A176r Variant In Complex With Nad Length = 332 Back     alignment and structure
>pdb|2W2K|A Chain A, Crystal Structure Of The Apo Forms Of Rhodotorula Graminis D-Mandelate Dehydrogenase At 1.8a. Length = 348 Back     alignment and structure
>pdb|2W2K|B Chain B, Crystal Structure Of The Apo Forms Of Rhodotorula Graminis D-Mandelate Dehydrogenase At 1.8a Length = 348 Back     alignment and structure
>pdb|2W2L|D Chain D, Crystal Structure Of The Holo Forms Of Rhodotorula Graminis D-Mandelate Dehydrogenase At 2.5a Length = 348 Back     alignment and structure
>pdb|1WWK|A Chain A, Crystal Structure Of Phosphoglycerate Dehydrogenase From Pyrococcus Horikoshii Ot3 Length = 307 Back     alignment and structure
>pdb|4DGS|A Chain A, The Crystals Structure Of Dehydrogenase From Rhizobium Meliloti Length = 340 Back     alignment and structure
>pdb|2EKL|A Chain A, Structure Of St1218 Protein From Sulfolobus Tokodaii Length = 313 Back     alignment and structure
>pdb|2P9C|A Chain A, Crystal Structure Of Serine Bound G336v Mutant Of E.Coli Phosphoglycerate Dehydrogenase Length = 410 Back     alignment and structure
>pdb|2P9G|A Chain A, Crystal Structure Of Serine Bound G336v,G337v Double Mutant Of E.Coli Phosphoglycerate Dehydrogenase Length = 410 Back     alignment and structure
>pdb|2J6I|A Chain A, Candida Boidinii Formate Dehydrogenase (Fdh) C-Terminal Mutant Length = 364 Back     alignment and structure
>pdb|2FSS|A Chain A, Candida Boidinii Formate Dehydrogenase (Fdh) K47e Mutant Length = 365 Back     alignment and structure
>pdb|3KB6|A Chain A, Crystal Structure Of D-lactate Dehydrogenase From Aquifex Aeolicus Complexed With Nad And Lactic Acid Length = 334 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query244
2dbq_A 334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 3e-60
1gdh_A 320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 4e-60
2cuk_A 311 Glycerate dehydrogenase/glyoxylate reductase; stru 1e-58
2gcg_A 330 Glyoxylate reductase/hydroxypyruvate reductase; NA 2e-58
4g2n_A 345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 1e-57
4e5n_A 330 Thermostable phosphite dehydrogenase; D-2-hydroxya 4e-57
2d0i_A 333 Dehydrogenase; structural genomics, NPPSFA, nation 1e-52
2w2k_A 348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 1e-49
4dgs_A 340 Dehydrogenase; structural genomics, PSI-biology, N 4e-49
3ba1_A 333 HPPR, hydroxyphenylpyruvate reductase; two domain 1e-47
1qp8_A 303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 3e-44
1mx3_A 347 CTBP1, C-terminal binding protein 1; nuclear prote 8e-44
1wwk_A 307 Phosphoglycerate dehydrogenase; riken structural g 2e-43
1j4a_A 333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 3e-43
2pi1_A 334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 7e-43
1xdw_A 331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 1e-42
2nac_A 393 NAD-dependent formate dehydrogenase; oxidoreductas 4e-41
1dxy_A 333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 1e-39
3jtm_A 351 Formate dehydrogenase, mitochondrial; mitochondrio 5e-39
3gvx_A 290 Glycerate dehydrogenase related protein; NYSGXRC, 7e-38
2g76_A 335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 1e-35
2ekl_A 313 D-3-phosphoglycerate dehydrogenase; structural gen 3e-35
1ygy_A 529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 4e-35
3gg9_A 352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 4e-35
3k5p_A 416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 2e-34
1sc6_A 404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 6e-34
2j6i_A 364 Formate dehydrogenase; oxidoreductase, D-specific- 4e-33
3evt_A 324 Phosphoglycerate dehydrogenase; structural genomic 5e-29
2o4c_A 380 Erythronate-4-phosphate dehydrogenase; erythronate 3e-23
3oet_A 381 Erythronate-4-phosphate dehydrogenase; structural 6e-23
3hg7_A 324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 1e-07
3pp8_A 315 Glyoxylate/hydroxypyruvate reductase A; structural 2e-05
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 9e-05
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Length = 334 Back     alignment and structure
 Score =  192 bits (489), Expect = 3e-60
 Identities = 73/234 (31%), Positives = 121/234 (51%), Gaps = 27/234 (11%)

Query: 15  KYRVVSTKPMPGTRWINLLIEQDCRVEICTQKKTILSVEDIIALIGDKCDGVIGQLTEDW 74
           K +V  T+ +P    I +L E +  VE+    +  +  E ++  + +  D ++  L+E  
Sbjct: 2   KPKVFITREIP-EVGIKML-EDEFEVEVW-GDEKEIPREILLKKVKE-VDALVTMLSERI 57

Query: 75  GETLFAALSRAGGKAFSNMAVGYNNVDVNAANKYGIAVGNTPGVLTETTAELAASLSLAA 134
            + +F    +   +  +N AVGY+N+D+  A K GI V NTP VLT+ TA+LA +L LA 
Sbjct: 58  DKEVFENAPKL--RIVANYAVGYDNIDIEEATKRGIYVTNTPDVLTDATADLAFALLLAT 115

Query: 135 ARRIVEADEFMRAG----LYDGWLPNLFVGNLLKGQTVGVIGAGRIGSAYARMMVEGFKM 190
           AR +V+ D F+R+G        W P  F+G  + G+T+G+IG GRIG A A+   +GF M
Sbjct: 116 ARHVVKGDRFVRSGEWKKRGVAWHPKWFLGYDVYGKTIGIIGLGRIGQAIAKRA-KGFNM 174

Query: 191 NLIYYDLYQATRLEKFVTAYGQFLKANGEQPVTWKRASSMDEVLREADVVCTLC 244
            ++YY   +   +E+ + A                    ++++LRE+D V    
Sbjct: 175 RILYYSRTRKEEVERELNA----------------EFKPLEDLLRESDFVVLAV 212


>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Length = 320 Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Length = 311 Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Length = 330 Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Length = 345 Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Length = 330 Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Length = 333 Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Length = 348 Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Length = 340 Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Length = 333 Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Length = 303 Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Length = 347 Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Length = 307 Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Length = 333 Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Length = 331 Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Length = 393 Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Length = 333 Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Length = 351 Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Length = 290 Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Length = 335 Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Length = 313 Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Length = 529 Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Length = 352 Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Length = 416 Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Length = 404 Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Length = 364 Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Length = 324 Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Length = 380 Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Length = 381 Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Length = 324 Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Length = 315 Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Length = 293 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query244
4g2n_A 345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 100.0
4e5n_A 330 Thermostable phosphite dehydrogenase; D-2-hydroxya 100.0
4dgs_A 340 Dehydrogenase; structural genomics, PSI-biology, N 100.0
3k5p_A 416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 100.0
3kb6_A 334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 100.0
1sc6_A 404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 100.0
2g76_A 335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 100.0
1gdh_A 320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 100.0
2cuk_A 311 Glycerate dehydrogenase/glyoxylate reductase; stru 100.0
2yq5_A 343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 100.0
3hg7_A 324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 100.0
1wwk_A 307 Phosphoglycerate dehydrogenase; riken structural g 100.0
2ekl_A 313 D-3-phosphoglycerate dehydrogenase; structural gen 100.0
3gg9_A 352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 100.0
2pi1_A 334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 100.0
2gcg_A 330 Glyoxylate reductase/hydroxypyruvate reductase; NA 100.0
3jtm_A 351 Formate dehydrogenase, mitochondrial; mitochondrio 100.0
3evt_A 324 Phosphoglycerate dehydrogenase; structural genomic 100.0
1j4a_A 333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 100.0
3ba1_A 333 HPPR, hydroxyphenylpyruvate reductase; two domain 100.0
1xdw_A 331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 100.0
1dxy_A 333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 100.0
2dbq_A 334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 100.0
2j6i_A 364 Formate dehydrogenase; oxidoreductase, D-specific- 100.0
2nac_A 393 NAD-dependent formate dehydrogenase; oxidoreductas 100.0
2d0i_A 333 Dehydrogenase; structural genomics, NPPSFA, nation 100.0
1ygy_A 529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 100.0
4hy3_A 365 Phosphoglycerate oxidoreductase; PSI-biology, stru 100.0
1mx3_A 347 CTBP1, C-terminal binding protein 1; nuclear prote 100.0
2w2k_A 348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 100.0
3pp8_A 315 Glyoxylate/hydroxypyruvate reductase A; structural 100.0
1qp8_A 303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 100.0
3oet_A 381 Erythronate-4-phosphate dehydrogenase; structural 100.0
3gvx_A 290 Glycerate dehydrogenase related protein; NYSGXRC, 99.97
2o4c_A 380 Erythronate-4-phosphate dehydrogenase; erythronate 99.97
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 99.93
2rir_A300 Dipicolinate synthase, A chain; structural genomic 99.87
1v8b_A 479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 99.77
3d64_A 494 Adenosylhomocysteinase; structural genomics, ssgci 99.77
2vhw_A 377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 99.57
1x13_A 401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 99.48
1l7d_A 384 Nicotinamide nucleotide transhydrogenase, subunit 99.46
3ce6_A 494 Adenosylhomocysteinase; protein-substrate complex, 99.44
3h9u_A 436 Adenosylhomocysteinase; NAD CO-factor complex, str 99.26
2eez_A 369 Alanine dehydrogenase; TTHA0216, structural genomi 99.24
3n58_A 464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 99.19
1gpj_A 404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 99.17
3gvp_A 435 Adenosylhomocysteinase 3; protein CO-factor comple 99.04
3dtt_A 245 NADP oxidoreductase; structural genomics, joint ce 98.79
3p2y_A 381 Alanine dehydrogenase/pyridine nucleotide transhy; 98.78
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 98.65
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 98.62
1c1d_A 355 L-phenylalanine dehydrogenase; amino acid dehydrog 98.61
3qsg_A 312 NAD-binding phosphogluconate dehydrogenase-like P; 98.54
3doj_A 310 AT3G25530, dehydrogenase-like protein; gamma-hydro 98.53
2pv7_A 298 T-protein [includes: chorismate mutase (EC 5.4.99 98.5
3ond_A 488 Adenosylhomocysteinase; plant protein, enzyme-subs 98.45
4dio_A 405 NAD(P) transhydrogenase subunit alpha PART 1; stru 98.42
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 98.42
1np3_A 338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 98.33
1leh_A 364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 98.32
4dll_A 320 2-hydroxy-3-oxopropionate reductase; structural ge 98.3
1gtm_A 419 Glutamate dehydrogenase; oxidoreductase, NAD, NADP 98.26
3l6d_A 306 Putative oxidoreductase; structural genomics, prot 98.25
3fr7_A 525 Putative ketol-acid reductoisomerase (OS05G057370 98.25
3pef_A 287 6-phosphogluconate dehydrogenase, NAD-binding; gam 98.24
3ggo_A 314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 98.15
2h78_A 302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 98.13
3pdu_A 287 3-hydroxyisobutyrate dehydrogenase family protein; 98.13
3p2o_A285 Bifunctional protein fold; structural genomics, ce 98.12
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 98.1
3ktd_A 341 Prephenate dehydrogenase; structural genomics, joi 98.1
2yjz_A 201 Metalloreductase steap4; oxidoreductase, metabolic 97.37
1pjc_A 361 Protein (L-alanine dehydrogenase); oxidoreductase, 98.09
4e21_A 358 6-phosphogluconate dehydrogenase (decarboxylating; 98.08
3obb_A 300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 98.08
4ezb_A 317 Uncharacterized conserved protein; structural geno 98.07
2ahr_A 259 Putative pyrroline carboxylate reductase; pyrrolin 98.07
4gbj_A 297 6-phosphogluconate dehydrogenase NAD-binding; stru 98.07
3gt0_A 247 Pyrroline-5-carboxylate reductase; structural geno 98.06
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 98.05
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 98.04
3l07_A285 Bifunctional protein fold; structural genomics, ID 98.04
3qha_A 296 Putative oxidoreductase; seattle structural genomi 98.03
3g0o_A 303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 98.02
2g5c_A 281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 98.02
2gf2_A 296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 98.01
3d1l_A 266 Putative NADP oxidoreductase BF3122; structural ge 97.98
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 97.98
2i99_A 312 MU-crystallin homolog; thyroid hormine binding pro 97.96
3cky_A 301 2-hydroxymethyl glutarate dehydrogenase; rossmann 97.94
4e12_A 283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 97.94
3tri_A 280 Pyrroline-5-carboxylate reductase; amino acid bios 97.93
2vns_A 215 Metalloreductase steap3; metal-binding, transmembr 97.93
2uyy_A 316 N-PAC protein; long-chain dehydrogenase, cytokine; 97.9
1i36_A 264 Conserved hypothetical protein MTH1747; NADP bindi 97.89
1vpd_A 299 Tartronate semialdehyde reductase; structural geno 97.86
1yb4_A 295 Tartronic semialdehyde reductase; structural genom 97.8
3b1f_A 290 Putative prephenate dehydrogenase; enzyme, 4-hydro 97.8
2f1k_A 279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 97.79
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 97.78
2rcy_A 262 Pyrroline carboxylate reductase; malaria, structur 97.76
2raf_A 209 Putative dinucleotide-binding oxidoreductase; NP_7 97.76
4huj_A 220 Uncharacterized protein; PSI-biology, nysgrc, stru 97.76
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 97.76
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 97.75
3c24_A 286 Putative oxidoreductase; YP_511008.1, structural g 97.73
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 97.71
3c85_A183 Putative glutathione-regulated potassium-efflux S 97.69
3q2o_A 389 Phosphoribosylaminoimidazole carboxylase, ATPase; 97.68
2cvz_A 289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 97.68
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 97.67
2izz_A 322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 97.66
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 97.66
1yqg_A 263 Pyrroline-5-carboxylate reductase; structural geno 97.64
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 97.64
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 97.61
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 97.6
1zej_A 293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 97.59
1jay_A 212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 97.55
2dpo_A 319 L-gulonate 3-dehydrogenase; structural genomics, N 97.55
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 97.55
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 97.51
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 97.5
1f0y_A 302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 97.48
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 97.47
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 97.46
1bg6_A 359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 97.44
3k6j_A 460 Protein F01G10.3, confirmed by transcript evidenc; 97.42
2z2v_A 365 Hypothetical protein PH1688; L-lysine dehydrogenas 97.4
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 97.4
1id1_A153 Putative potassium channel protein; RCK domain, E. 97.39
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 97.39
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 97.39
1x7d_A 350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 97.38
1lss_A140 TRK system potassium uptake protein TRKA homolog; 97.36
3pid_A 432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 97.36
1pgj_A 478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 97.36
3hdj_A 313 Probable ornithine cyclodeaminase; APC62486, borde 97.35
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 97.35
1evy_A 366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 97.33
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 97.32
1mv8_A 436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 97.3
3uuw_A 308 Putative oxidoreductase with NAD(P)-binding rossm 97.3
3db2_A 354 Putative NADPH-dependent oxidoreductase; two domai 97.29
3k96_A 356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 97.28
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 97.28
2q3e_A 467 UDP-glucose 6-dehydrogenase; hexamer, structural g 97.28
1omo_A 322 Alanine dehydrogenase; two-domain, beta-sandwich-d 97.24
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 97.23
4hkt_A 331 Inositol 2-dehydrogenase; structural genomics, nys 97.22
1dlj_A 402 UDP-glucose dehydrogenase; rossmann fold, ternary 97.22
3euw_A 344 MYO-inositol dehydrogenase; protein structure init 97.22
1txg_A 335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 97.21
3orq_A 377 N5-carboxyaminoimidazole ribonucleotide synthetas; 97.2
3dfz_A 223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 97.19
3q2i_A 354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 97.18
1x0v_A 354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 97.14
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 97.12
1z82_A 335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 97.09
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 97.08
4b4u_A303 Bifunctional protein fold; oxidoreductase; HET: NA 97.07
3e9m_A 330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 97.05
3mz0_A 344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 97.05
3ezy_A 344 Dehydrogenase; structural genomics, unknown functi 97.04
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 97.03
4a7p_A 446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 97.03
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 97.02
1jw9_B 249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 97.02
1yj8_A 375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 96.99
2o3j_A 481 UDP-glucose 6-dehydrogenase; structural genomics, 96.98
1ks9_A 291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 96.98
2ho3_A 325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 96.97
3m2t_A 359 Probable dehydrogenase; PSI, SGXNY, structural gen 96.96
2i76_A 276 Hypothetical protein; NADP, dehydrogenase, TM1727, 96.95
3mog_A 483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 96.95
2ew2_A 316 2-dehydropantoate 2-reductase, putative; alpha-str 96.94
3ohs_X 334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 96.92
3rc1_A 350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 96.91
2y0c_A 478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 96.89
3ec7_A 357 Putative dehydrogenase; alpha-beta, structural gen 96.89
3evn_A 329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 96.88
3ghy_A 335 Ketopantoate reductase protein; oxidoreductase, NA 96.86
3e18_A 359 Oxidoreductase; dehydrogenase, NAD-binding, struct 96.86
2duw_A145 Putative COA-binding protein; ligand binding prote 96.81
3cea_A 346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 96.81
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 96.79
2glx_A 332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 96.79
2vt3_A215 REX, redox-sensing transcriptional repressor REX; 96.73
3e8x_A 236 Putative NAD-dependent epimerase/dehydratase; stru 96.71
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 96.71
4e4t_A 419 Phosphoribosylaminoimidazole carboxylase, ATPase; 96.7
2qrj_A394 Saccharopine dehydrogenase, NAD+, L-lysine- formin 96.7
3e82_A 364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 96.7
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 96.67
3i83_A 320 2-dehydropantoate 2-reductase; structural genomics 96.67
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 96.64
3c1a_A 315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 96.64
3bio_A 304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 96.63
1xea_A 323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 96.63
1ydw_A 362 AX110P-like protein; structural genomics, protein 96.63
1tlt_A 319 Putative oxidoreductase (virulence factor MVIM HO; 96.61
2qyt_A 317 2-dehydropantoate 2-reductase; APC81190, porphyrom 96.61
3c7a_A 404 Octopine dehydrogenase; L) stereospecific opine de 96.61
2i6u_A307 Otcase, ornithine carbamoyltransferase; X-RAY crys 96.59
3qy9_A 243 DHPR, dihydrodipicolinate reductase; rossmann fold 96.57
1f06_A 320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 96.56
3g79_A 478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 96.54
1zcj_A 463 Peroxisomal bifunctional enzyme; peroxisomal multi 96.54
1guz_A 310 Malate dehydrogenase; oxidoreductase, tricarboxyli 96.53
3kux_A 352 Putative oxidoreductase; oxidoreductase family, cs 96.52
3hwr_A 318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 96.51
2czc_A 334 Glyceraldehyde-3-phosphate dehydrogenase; glycolys 96.5
3hn2_A 312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 96.5
4fb5_A 393 Probable oxidoreductase protein; PSI-biology, nysg 96.5
4had_A 350 Probable oxidoreductase protein; structural genomi 96.48
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 96.48
3gdo_A 358 Uncharacterized oxidoreductase YVAA; structural ge 96.47
1pzg_A 331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 96.47
3ojo_A 431 CAP5O; rossmann fold, complex with cofactor NAD an 96.46
4f3y_A 272 DHPR, dihydrodipicolinate reductase; structural ge 96.46
3l4b_C 218 TRKA K+ channel protien TM1088B; potassium channel 96.45
3ado_A 319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 96.44
1vl6_A 388 Malate oxidoreductase; TM0542, NAD-dependent malic 96.43
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 96.42
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 96.42
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 96.42
2d59_A144 Hypothetical protein PH1109; COA binding, structur 96.42
3ijp_A 288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 96.42
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 96.4
1h6d_A 433 Precursor form of glucose-fructose oxidoreductase; 96.39
2aef_A 234 Calcium-gated potassium channel MTHK; rossmann fol 96.38
2ewd_A 317 Lactate dehydrogenase,; protein-substrate_cofactor 96.37
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 96.37
3aog_A 440 Glutamate dehydrogenase; NAD(H), oxidoreducta; HET 96.34
4gqa_A 412 NAD binding oxidoreductase; structural genomics, P 96.3
3f4l_A 345 Putative oxidoreductase YHHX; structural genomics, 96.29
1pjq_A 457 CYSG, siroheme synthase; rossman fold, nucleotide 96.28
1b7g_O 340 Protein (glyceraldehyde 3-phosphate dehydrogenase; 96.25
3fi9_A 343 Malate dehydrogenase; structural genomics, oxidore 96.23
1vlv_A325 Otcase, ornithine carbamoyltransferase; TM1097, st 96.22
1zh8_A 340 Oxidoreductase; TM0312, structural genomics, JO ce 96.22
1hyh_A 309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 96.21
1dxh_A 335 Ornithine carbamoyltransferase; transcarbamylase; 96.2
2dt5_A211 AT-rich DNA-binding protein; REX, NADH, NAD, rossm 96.19
2wtb_A 725 MFP2, fatty acid multifunctional protein (ATMFP2); 96.16
1pg5_A299 Aspartate carbamoyltransferase; 2.60A {Sulfolobus 96.15
3moi_A 387 Probable dehydrogenase; structural genomics, PSI2, 96.15
1zud_1 251 Adenylyltransferase THIF; thiamin, thiazole, prote 96.15
3keo_A212 Redox-sensing transcriptional repressor REX; DNA b 96.12
4ew6_A 330 D-galactose-1-dehydrogenase protein; nysgrc, PSI-b 96.07
1hdo_A 206 Biliverdin IX beta reductase; foetal metabolism, H 96.06
3dhn_A 227 NAD-dependent epimerase/dehydratase; reductase, PF 96.05
3h9e_O 346 Glyceraldehyde-3-phosphate dehydrogenase, testis-; 96.04
2w37_A 359 Ornithine carbamoyltransferase, catabolic; transca 96.03
3ego_A 307 Probable 2-dehydropantoate 2-reductase; structural 96.02
4ina_A 405 Saccharopine dehydrogenase; structural genomics, P 96.01
1iuk_A140 Hypothetical protein TT1466; structural genomics, 96.01
4dmm_A 269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 96.01
3eag_A 326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 96.0
1oth_A321 Protein (ornithine transcarbamoylase); transferase 95.99
3ulk_A 491 Ketol-acid reductoisomerase; branched-chain amino 95.98
3d6n_B291 Aspartate carbamoyltransferase; reactor, chamber, 95.98
3fhl_A 362 Putative oxidoreductase; NAD-binding domain, PSI-2 95.98
1hdg_O 332 Holo-D-glyceraldehyde-3-phosphate dehydrogenase; o 95.95
1wdk_A 715 Fatty oxidation complex alpha subunit; alpha2BETA2 95.95
3i23_A 349 Oxidoreductase, GFO/IDH/MOCA family; structural ge 95.94
1xq6_A 253 Unknown protein; structural genomics, protein stru 95.94
3vtf_A 444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 95.93
1u8f_O 335 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l 95.91
1cf2_P 337 Protein (glyceraldehyde-3-phosphate dehydrogenase) 95.91
3qvo_A 236 NMRA family protein; structural genomics, PSI-biol 95.91
4amu_A 365 Ornithine carbamoyltransferase, catabolic; ornithi 95.9
3r7f_A304 Aspartate carbamoyltransferase; aspartate transcar 95.88
1ml4_A308 Aspartate transcarbamoylase; beta pleated sheet, p 95.87
4gmf_A 372 Yersiniabactin biosynthetic protein YBTU; rossmann 95.86
3vku_A 326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 95.86
3gpi_A 286 NAD-dependent epimerase/dehydratase; structural ge 95.85
3vtf_A444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 95.83
2p2s_A 336 Putative oxidoreductase; YP_050235.1, structural g 95.82
2hjr_A 328 Malate dehydrogenase; malaria, structural genomics 95.81
3cmc_O 334 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; m 95.81
2tmg_A 415 Protein (glutamate dehydrogenase); metabolic role, 95.8
3r6d_A 221 NAD-dependent epimerase/dehydratase; structural ge 95.8
2ef0_A301 Ornithine carbamoyltransferase; TTHA1199, thermus 95.77
3dty_A 398 Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram 95.76
1pvv_A315 Otcase, ornithine carbamoyltransferase; dodecamer; 95.75
4h3v_A 390 Oxidoreductase domain protein; structural genomics 95.71
1ldn_A 316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 95.71
1a5z_A 319 L-lactate dehydrogenase; oxidoreductase, glycolysi 95.71
1t2d_A 322 LDH-P, L-lactate dehydrogenase; ternary complex, o 95.69
3u3x_A 361 Oxidoreductase; structural genomics, PSI-biology, 95.69
3tl2_A 315 Malate dehydrogenase; center for structural genomi 95.66
3nrc_A 280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 95.65
3g17_A 294 Similar to 2-dehydropantoate 2-reductase; structur 95.64
1duv_G 333 Octase-1, ornithine transcarbamoylase; enzyme-inhi 95.64
4h31_A358 Otcase, ornithine carbamoyltransferase; structural 95.63
3v5n_A 417 Oxidoreductase; structural genomics, PSI-biology, 95.63
2bka_A 242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 95.62
4id9_A 347 Short-chain dehydrogenase/reductase; putative dehy 95.6
1lld_A 319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 95.59
4ekn_B306 Aspartate carbamoyltransferase; atcase, aspartate 95.58
2pzm_A 330 Putative nucleotide sugar epimerase/ dehydratase; 95.58
3afn_B 258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 95.58
3k31_A 296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 95.57
3dqp_A 219 Oxidoreductase YLBE; alpha-beta protein., structur 95.56
4da9_A 280 Short-chain dehydrogenase/reductase; structural ge 95.56
4ep1_A340 Otcase, ornithine carbamoyltransferase; structural 95.54
3k5i_A 403 Phosphoribosyl-aminoimidazole carboxylase; purine 95.52
2x5j_O 339 E4PDH, D-erythrose-4-phosphate dehydrogenase; oxid 95.51
3o38_A 266 Short chain dehydrogenase; tuberculosis, ortholog 95.5
2ixa_A 444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver 95.5
3ijr_A 291 Oxidoreductase, short chain dehydrogenase/reducta; 95.49
2nu8_A 288 Succinyl-COA ligase [ADP-forming] subunit alpha; c 95.49
3btv_A 438 Galactose/lactose metabolism regulatory protein GA 95.46
3ek2_A 271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 95.45
2nvw_A 479 Galactose/lactose metabolism regulatory protein GA 95.45
1obb_A 480 Maltase, alpha-glucosidase; glycosidase, sulfinic 95.43
3q98_A 399 Transcarbamylase; rossmann fold, transferase; 2.00 95.42
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 95.42
3qiv_A 253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 95.35
2yyy_A 343 Glyceraldehyde-3-phosphate dehydrogenase; glyceral 95.33
1oju_A 294 MDH, malate dehydrogenase; hyperthermophilic, oxid 95.32
3pqe_A 326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 95.32
3ldh_A 330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 95.32
2p91_A 285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 95.31
3e5r_O 337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 95.3
2h7i_A 269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 95.29
1ur5_A 309 Malate dehydrogenase; oxidoreductase, tricarboxyli 95.29
2z1m_A 345 GDP-D-mannose dehydratase; short-chain dehydrogena 95.29
3gvi_A 324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 95.28
3v2g_A 271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 95.23
3rft_A 267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 95.22
3ruf_A 351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 95.22
2q2v_A 255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 95.2
3pid_A432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 95.19
3rkr_A 262 Short chain oxidoreductase; rossmann fold; HET: NA 95.19
3o9z_A 312 Lipopolysaccaride biosynthesis protein WBPB; oxido 95.19
3b1j_A 339 Glyceraldehyde 3-phosphate dehydrogenase (NADP+); 95.19
3oa2_A 318 WBPB; oxidoreductase, sugar biosynthesis, dehydrog 95.19
3ius_A 286 Uncharacterized conserved protein; APC63810, silic 95.18
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 95.18
3r1i_A 276 Short-chain type dehydrogenase/reductase; structur 95.18
2pd4_A 275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 95.17
1gee_A 261 Glucose 1-dehydrogenase; short-chain dehydrogenase 95.17
3fef_A 450 Putative glucosidase LPLD; gulosidase, structural 95.17
2v6b_A 304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 95.16
3csu_A310 Protein (aspartate carbamoyltransferase); transfer 95.16
1gad_O 330 D-glyceraldehyde-3-phosphate dehydrogenase; oxidor 95.14
3p7m_A 321 Malate dehydrogenase; putative dehydrogenase, enzy 95.13
1j5p_A 253 Aspartate dehydrogenase; TM1643, structural genomi 95.12
1fmc_A 255 7 alpha-hydroxysteroid dehydrogenase; short-chain 95.11
1nvm_B 312 Acetaldehyde dehydrogenase (acylating), 4-hydroxy- 95.1
3dfu_A 232 Uncharacterized protein from 6-phosphogluconate de 95.09
3upl_A 446 Oxidoreductase; rossmann fold, NADPH binding; 1.50 95.08
3i6i_A 346 Putative leucoanthocyanidin reductase 1; rossmann 95.08
3ew7_A 221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 95.05
2gn4_A 344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 95.05
2wm3_A 299 NMRA-like family domain containing protein 1; unkn 95.04
4iin_A 271 3-ketoacyl-acyl carrier protein reductase (FABG); 95.03
2d8a_A 348 PH0655, probable L-threonine 3-dehydrogenase; pyro 95.03
1v9l_A 421 Glutamate dehydrogenase; protein-NAD complex, oxid 95.01
1w6u_A 302 2,4-dienoyl-COA reductase, mitochondrial precursor 95.0
4fgw_A 391 Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxi 94.98
1sb8_A 352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 94.96
1kyq_A 274 Met8P, siroheme biosynthesis protein Met8; homodim 94.94
2dvm_A 439 Malic enzyme, 439AA long hypothetical malate oxido 94.94
3v2h_A 281 D-beta-hydroxybutyrate dehydrogenase; structural g 94.94
2uvd_A 246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 94.93
2d2i_A 380 Glyceraldehyde 3-phosphate dehydrogenase; rossmann 94.93
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 94.92
3tpf_A307 Otcase, ornithine carbamoyltransferase; structural 94.9
1dlj_A402 UDP-glucose dehydrogenase; rossmann fold, ternary 94.9
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 94.9
4iiu_A 267 3-oxoacyl-[acyl-carrier protein] reductase; struct 94.89
4f2g_A309 Otcase 1, ornithine carbamoyltransferase 1; struct 94.89
3rui_A 340 Ubiquitin-like modifier-activating enzyme ATG7; au 94.88
4dry_A 281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 94.86
1mld_A 314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 94.86
2x5o_A 439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 94.85
1cdo_A 374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 94.84
1ys4_A 354 Aspartate-semialdehyde dehydrogenase; oxidoreducta 94.84
3gdg_A 267 Probable NADP-dependent mannitol dehydrogenase; ro 94.84
3ojo_A431 CAP5O; rossmann fold, complex with cofactor NAD an 94.83
3h7a_A 252 Short chain dehydrogenase; oxidoreductase, PSI-2, 94.83
2q1w_A 333 Putative nucleotide sugar epimerase/ dehydratase; 94.82
3awd_A 260 GOX2181, putative polyol dehydrogenase; oxidoreduc 94.81
3lyl_A 247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 94.8
2jhf_A 374 Alcohol dehydrogenase E chain; oxidoreductase, met 94.8
4ej6_A 370 Putative zinc-binding dehydrogenase; structural ge 94.79
4fn4_A 254 Short chain dehydrogenase; NADH-binding, rossmann 94.79
1xyg_A 359 Putative N-acetyl-gamma-glutamyl-phosphate reduct; 94.78
1ja9_A 274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 94.77
3slg_A 372 PBGP3 protein; structural genomics, seattle struct 94.77
3h2s_A 224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 94.77
1zq6_A359 Otcase, ornithine carbamoyltransferase; alpha/beta 94.75
1dih_A 273 Dihydrodipicolinate reductase; oxidoreductase; HET 94.74
3ai3_A 263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 94.74
3edm_A 259 Short chain dehydrogenase; structural genomics, ox 94.73
4ibo_A 271 Gluconate dehydrogenase; enzyme function initiativ 94.73
2ejw_A 332 HDH, homoserine dehydrogenase; NAD-dependent, oxid 94.73
3cps_A 354 Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g 94.72
3oig_A 266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 94.72
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 94.72
3grk_A 293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 94.71
1e3i_A 376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 94.7
1rm4_O 337 Glyceraldehyde 3-phosphate dehydrogenase A; rossma 94.7
3is3_A 270 17BETA-hydroxysteroid dehydrogenase; short chain d 94.7
1qsg_A 265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 94.7
3grf_A328 Ornithine carbamoyltransferase; ornithine transcar 94.69
2ydy_A 315 Methionine adenosyltransferase 2 subunit beta; oxi 94.69
1lc0_A 294 Biliverdin reductase A; oxidoreductase, tetrapyrro 94.68
3imf_A 257 Short chain dehydrogenase; structural genomics, in 94.67
3m2p_A 311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 94.65
1qyc_A 308 Phenylcoumaran benzylic ether reductase PT1; NADPH 94.64
3rwb_A 247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 94.63
3ip1_A 404 Alcohol dehydrogenase, zinc-containing; structural 94.63
4g81_D 255 Putative hexonate dehydrogenase; enzyme function i 94.63
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 94.62
3ay3_A 267 NAD-dependent epimerase/dehydratase; glucuronic ac 94.62
3sju_A 279 Keto reductase; short-chain dehydrogenase, oxidore 94.62
1smk_A 326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 94.61
3gd5_A323 Otcase, ornithine carbamoyltransferase; structural 94.6
1yb1_A 272 17-beta-hydroxysteroid dehydrogenase type XI; shor 94.6
2hq1_A 247 Glucose/ribitol dehydrogenase; CTH-1438, structura 94.59
3sx2_A 278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 94.58
3tjr_A 301 Short chain dehydrogenase; structural genomics, se 94.58
3t7c_A 299 Carveol dehydrogenase; structural genomics, seattl 94.57
2yfk_A 418 Aspartate/ornithine carbamoyltransferase; transcar 94.57
1js1_X324 Transcarbamylase; alpha/beta topology, two domains 94.56
3i4f_A 264 3-oxoacyl-[acyl-carrier protein] reductase; struct 94.56
1xg5_A 279 ARPG836; short chain dehydrogenase, human, SGC, st 94.55
4fc7_A 277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 94.55
1oi7_A 288 Succinyl-COA synthetase alpha chain; SCS, ligase, 94.54
1qyd_A 313 Pinoresinol-lariciresinol reductase; NADPH-depende 94.54
3aoe_E 419 Glutamate dehydrogenase; rossmann fold, NADH, oxid 94.53
3tox_A 280 Short chain dehydrogenase; structural genomics, PS 94.52
3s55_A 281 Putative short-chain dehydrogenase/reductase; stru 94.51
2wyu_A 261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 94.51
3sc4_A 285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 94.5
2p4h_X 322 Vestitone reductase; NADPH-dependent reductase, is 94.5
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 94.45
1p0f_A 373 NADP-dependent alcohol dehydrogenase; ADH topology 94.44
3pgx_A 280 Carveol dehydrogenase; structural genomics, seattl 94.41
3uve_A 286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 94.41
2yfq_A 421 Padgh, NAD-GDH, NAD-specific glutamate dehydrogena 94.4
3f1l_A 252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 94.39
3mtj_A 444 Homoserine dehydrogenase; rossmann-fold, PSI, MCSG 94.38
1s6y_A 450 6-phospho-beta-glucosidase; hydrolase, structural 94.36
2fzw_A 373 Alcohol dehydrogenase class III CHI chain; S-nitro 94.36
3cxt_A 291 Dehydrogenase with different specificities; rossma 94.35
2q1s_A 377 Putative nucleotide sugar epimerase/ dehydratase; 94.34
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 94.32
4hv4_A 494 UDP-N-acetylmuramate--L-alanine ligase; MURC, yers 94.3
1sny_A 267 Sniffer CG10964-PA; alpha and beta protein, rossma 94.3
3v8b_A 283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 94.3
4imr_A 275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 94.3
3nep_X 314 Malate dehydrogenase; halophIle, molecular adpatat 94.3
2pd6_A 264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 94.28
3ip3_A 337 Oxidoreductase, putative; structural genomics, PSI 94.28
4a8t_A339 Putrescine carbamoyltransferase; trabnsferase PALO 94.28
2ozp_A 345 N-acetyl-gamma-glutamyl-phosphate reductase; amino 94.26
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 94.26
3pxx_A 287 Carveol dehydrogenase; structural genomics, seattl 94.25
3pk0_A 262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 94.24
1xu9_A 286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 94.23
2b4q_A 276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 94.23
1y6j_A 318 L-lactate dehydrogenase; southeast collaboratory f 94.23
3enk_A 341 UDP-glucose 4-epimerase; seattle structural genomi 94.22
1x1t_A 260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 94.22
3oh8_A 516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 94.21
3ucx_A 264 Short chain dehydrogenase; ssgcid, seattle structu 94.21
4fs3_A 256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 94.21
2a9f_A 398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 94.21
4b7c_A 336 Probable oxidoreductase; NADP cofactor, rossmann f 94.21
3r3s_A 294 Oxidoreductase; structural genomics, csgid, center 94.2
3tsc_A 277 Putative oxidoreductase; structural genomics, seat 94.2
4aj2_A 331 L-lactate dehydrogenase A chain; oxidoreductase-in 94.19
3k92_A 424 NAD-GDH, NAD-specific glutamate dehydrogenase; ROC 94.19
3ftp_A 270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 94.19
1hdc_A 254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 94.18
3osu_A 246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 94.18
3uko_A 378 Alcohol dehydrogenase class-3; alcohol dehydrogena 94.18
2zqz_A 326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 94.18
1y8q_A 346 Ubiquitin-like 1 activating enzyme E1A; SUMO, hete 94.17
1u8x_X 472 Maltose-6'-phosphate glucosidase; structural genom 94.17
3rih_A 293 Short chain dehydrogenase or reductase; structural 94.15
1e6u_A 321 GDP-fucose synthetase; epimerase/reductase, SDR, R 94.11
1kol_A 398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 94.09
2x9g_A 288 PTR1, pteridine reductase; short chain dehydrogena 94.09
2r6j_A 318 Eugenol synthase 1; phenylpropene, PIP reductase, 94.09
4egf_A 266 L-xylulose reductase; structural genomics, ssgcid, 94.09
3rd5_A 291 Mypaa.01249.C; ssgcid, structural genomics, seattl 94.07
1f8f_A 371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 94.07
1cyd_A 244 Carbonyl reductase; short-chain dehydrogenase, oxi 94.06
2gas_A 307 Isoflavone reductase; NADPH-dependent reductase, o 94.05
1ez4_A 318 Lactate dehydrogenase; rossmann fold, oxidoreducta 94.05
1zk4_A 251 R-specific alcohol dehydrogenase; short chain redu 94.04
3d0o_A 317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 94.03
3vh1_A 598 Ubiquitin-like modifier-activating enzyme ATG7; au 94.03
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
Probab=100.00  E-value=1.9e-42  Score=306.74  Aligned_cols=215  Identities=26%  Similarity=0.401  Sum_probs=180.7

Q ss_pred             eeeeCCCCCeEEEEeCCCCchHHHHHHHhCCCeEEEeccCCCCCCHHHHHHHhcCCccEEEeccCccccHHHHHHh-hcc
Q 026023            7 IEVWNPNGKYRVVSTKPMPGTRWINLLIEQDCRVEICTQKKTILSVEDIIALIGDKCDGVIGQLTEDWGETLFAAL-SRA   85 (244)
Q Consensus         7 ~~~~~~~~~~~ilv~~~~~~~~~~~~l~~~~~~v~~~~~~~~~~~~~~~~~~~~~~ad~ii~~~~~~~~~~~l~~~-p~l   85 (244)
                      +.-++++.++|||++.+++++ ..+.|++. +++.+.. .+...+++++.+.+++ +|+++++...++++++++++ |+|
T Consensus        20 ~~~~~~~~~~kvlv~~~~~~~-~~~~l~~~-~~v~~~~-~~~~~~~~~l~~~~~~-~d~li~~~~~~i~~~~l~~~~~~L   95 (345)
T 4g2n_A           20 FQSMSTHPIQKAFLCRRFTPA-IEAELRQR-FDLEVNL-EDTVLTPSGIASRAHG-AEVLFVTATEAITAEVIRKLQPGL   95 (345)
T ss_dssp             -------CCCEEEESSCCCHH-HHHHHHHH-SEEEECT-TCCCCCHHHHHHHTTT-CSEEEECTTSCBCHHHHHHTTTTC
T ss_pred             eeecccCCCCEEEEeCCCCHH-HHHHHHcc-CCEEEec-CCCCCCHHHHHHHhcC-CeEEEEeCCCCCCHHHHHhhcCCc
Confidence            344456778999999998876 56778775 6887543 2335689999999985 99999987678999999998 688


Q ss_pred             CCcEEEEcccCCCccChHHHhhCCcEEEecCCCCCcchHHHHHHHHHHHHhChHHHHHHHHcCCCCCCCCCcccccccCC
Q 026023           86 GGKAFSNMAVGYNNVDVNAANKYGIAVGNTPGVLTETTAELAASLSLAAARRIVEADEFMRAGLYDGWLPNLFVGNLLKG  165 (244)
Q Consensus        86 ~~k~I~~~~aG~d~id~~~~~~~gI~v~n~~~~~~~~vAE~~l~~~L~~~R~~~~~~~~~~~~~w~~~~~~~~~~~~l~g  165 (244)
                        |||++.|+|+||||++++.++||.|+|+|++++.+||||+++++|++.|+++.+.+.+++|.|.+|.+....+.+|.|
T Consensus        96 --k~I~~~~~G~D~id~~~a~~~gI~V~n~pg~~~~~vAE~a~~l~L~~~R~~~~~~~~~r~g~W~~~~~~~~~g~~l~g  173 (345)
T 4g2n_A           96 --KTIATLSVGYDHIDMAAARSLGIKVLHTPDVLSDACAEIAMLLVLNACRRGYEADRMVRSGSWPGWGPTQLLGMGLTG  173 (345)
T ss_dssp             --CEEEESSSCCTTBCHHHHHHTTCEEECCCSCCHHHHHHHHHHHHHHHHHTHHHHHHHHHTTCCCCCCTTTTCBCCCTT
T ss_pred             --eEEEEcCCcccccCHHHHHhCCEEEEECCcccchHHHHHHHHHHHHHHhCHHHHHHHHHcCCCcccCcccccccccCC
Confidence              999999999999999999999999999999999999999999999999999999999999999887654456789999


Q ss_pred             CEEEEEcCChHHHHHHHHHhccCCcEEEEEcCCcchHHHHHHhhhhhhhhcCCCCCccccccCCHHHHhhhCCEEEEeC
Q 026023          166 QTVGVIGAGRIGSAYARMMVEGFKMNLIYYDLYQATRLEKFVTAYGQFLKANGEQPVTWKRASSMDEVLREADVVCTLC  244 (244)
Q Consensus       166 ~tvgIvG~G~IG~~vA~~la~afG~~V~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~ell~~sD~Vvl~~  244 (244)
                      +||||||+|+||+.+|+++ ++|||+|++|||++.+....           .     +..+.+++++++++||+|++||
T Consensus       174 ktvGIIGlG~IG~~vA~~l-~~~G~~V~~~dr~~~~~~~~-----------~-----g~~~~~~l~ell~~sDvV~l~~  235 (345)
T 4g2n_A          174 RRLGIFGMGRIGRAIATRA-RGFGLAIHYHNRTRLSHALE-----------E-----GAIYHDTLDSLLGASDIFLIAA  235 (345)
T ss_dssp             CEEEEESCSHHHHHHHHHH-HTTTCEEEEECSSCCCHHHH-----------T-----TCEECSSHHHHHHTCSEEEECS
T ss_pred             CEEEEEEeChhHHHHHHHH-HHCCCEEEEECCCCcchhhh-----------c-----CCeEeCCHHHHHhhCCEEEEec
Confidence            9999999999999999997 99999999999987542111           0     1233469999999999999996



>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus} SCOP: c.2.1.7 c.58.1.1 PDB: 1bvu_A 1euz_A Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>4b4u_A Bifunctional protein fold; oxidoreductase; HET: NAP; 1.45A {Acinetobacter baumannii atcc 19606} PDB: 4b4v_A* 4b4w_A* Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>2vt3_A REX, redox-sensing transcriptional repressor REX; transcriptional regulation, redox poise; HET: ATP; 2.0A {Bacillus subtilis} PDB: 2vt2_A* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A Back     alignment and structure
>2qrj_A Saccharopine dehydrogenase, NAD+, L-lysine- forming; sulfate, rossmann fold, alpha-aminoadipate pathway, fungal lysine biosynthesis; 1.60A {Saccharomyces cerevisiae} PDB: 2qrk_A* 2qrl_A* 2q99_A 3ugk_A 3uh1_A* 3uha_A* Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>2i6u_A Otcase, ornithine carbamoyltransferase; X-RAY crystallography, ornithine carbamyoltransferase, carbamoyl phosphate, L- norvaline; 2.20A {Mycobacterium tuberculosis} PDB: 2p2g_A Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3aog_A Glutamate dehydrogenase; NAD(H), oxidoreducta; HET: GLU; 2.10A {Thermus thermophilus HB27} PDB: 3aoe_A Back     alignment and structure
>4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} Back     alignment and structure
>3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>1vlv_A Otcase, ornithine carbamoyltransferase; TM1097, structural genomics, protein structure initiative, PSI, joint center for structu genomics; 2.25A {Thermotoga maritima} SCOP: c.78.1.1 c.78.1.1 Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1dxh_A Ornithine carbamoyltransferase; transcarbamylase; 2.50A {Pseudomonas aeruginosa} SCOP: c.78.1.1 c.78.1.1 PDB: 1ort_A Back     alignment and structure
>2dt5_A AT-rich DNA-binding protein; REX, NADH, NAD, rossmann fold, redox sensing, winged helix, themophilus; HET: NAD; 2.16A {Thermus thermophilus} SCOP: a.4.5.38 c.2.1.12 PDB: 1xcb_A* 3ikt_A* 3ikv_A 3il2_A* Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>1pg5_A Aspartate carbamoyltransferase; 2.60A {Sulfolobus acidocaldarius} SCOP: c.78.1.1 c.78.1.1 PDB: 2be9_A* Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>3keo_A Redox-sensing transcriptional repressor REX; DNA binding protein, winged helix, rossmann fold, NAD+; HET: NAD; 1.50A {Streptococcus agalactiae serogroup iiiorganism_taxid} PDB: 3keq_A* 3ket_A* Back     alignment and structure
>4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3h9e_O Glyceraldehyde-3-phosphate dehydrogenase, testis-; oxidoreductase, structural genomics, structural genomics CON SGC, glycolysis, NAD; HET: NAD; 1.72A {Homo sapiens} PDB: 3pfw_O* 2vyn_D* 2vyv_D* Back     alignment and structure
>2w37_A Ornithine carbamoyltransferase, catabolic; transcarbamylase, metal binding-site, hexamer, cytoplasm, arginine metabolism; 2.10A {Lactobacillus hilgardii} Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>1oth_A Protein (ornithine transcarbamoylase); transferase; HET: PAO; 1.85A {Homo sapiens} SCOP: c.78.1.1 c.78.1.1 PDB: 1ep9_A 1fvo_A 1c9y_A* 1fb5_A Back     alignment and structure
>3ulk_A Ketol-acid reductoisomerase; branched-chain amino acid biosynthesis, rossmann fold, acetolactate, oxidoreductase; HET: CSX NDP; 2.30A {Escherichia coli} PDB: 1yrl_A* Back     alignment and structure
>3d6n_B Aspartate carbamoyltransferase; reactor, chamber, pores, internal cavity, hydrolase, metal-B pyrimidine biosynthesis, hydrolase-transferase; HET: FLC; 2.30A {Aquifex aeolicus} Back     alignment and structure
>3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>1hdg_O Holo-D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehy(D)-NAD(A)); HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Back     alignment and structure
>1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>4amu_A Ornithine carbamoyltransferase, catabolic; ornithine transcarbamoylase, hydrolase; 2.50A {Mycoplasma penetrans} PDB: 4anf_A Back     alignment and structure
>3r7f_A Aspartate carbamoyltransferase; aspartate transcarbamoylase, carbamoyl phosphate, transferas catalytic cycle; 2.10A {Bacillus subtilis} PDB: 3r7d_A 3r7l_A* 2at2_A Back     alignment and structure
>1ml4_A Aspartate transcarbamoylase; beta pleated sheet, protein inhibitor complex, transferase; HET: PAL; 1.80A {Pyrococcus abyssi} SCOP: c.78.1.1 c.78.1.1 Back     alignment and structure
>4gmf_A Yersiniabactin biosynthetic protein YBTU; rossmann fold, NADPH dependent thiazoline reductase, oxidore; HET: EPE; 1.85A {Yersinia enterocolitica subsp} PDB: 4gmg_A* Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>3cmc_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; microspectrophotometry, reaction intermediate, dehydrogenase phosphate binding site; HET: G3H NAD; 1.77A {Bacillus stearothermophilus} SCOP: c.2.1.3 d.81.1.1 PDB: 2gd1_O 1gd1_O* 1npt_O* 1nqa_O* 1nqo_O* 1nq5_O* 2dbv_O* 1dbv_O* 3dbv_O* 4dbv_O* Back     alignment and structure
>2tmg_A Protein (glutamate dehydrogenase); metabolic role, mutant, oxidoreductase; 2.90A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.1 PDB: 1b26_A 1b3b_A Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>2ef0_A Ornithine carbamoyltransferase; TTHA1199, thermus thermophil structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Back     alignment and structure
>3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} Back     alignment and structure
>1pvv_A Otcase, ornithine carbamoyltransferase; dodecamer; 1.87A {Pyrococcus furiosus} SCOP: c.78.1.1 c.78.1.1 PDB: 1a1s_A Back     alignment and structure
>4h3v_A Oxidoreductase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.68A {Kribbella flavida} Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>1duv_G Octase-1, ornithine transcarbamoylase; enzyme-inhibitor complex, transferase; HET: PSQ; 1.70A {Escherichia coli} SCOP: c.78.1.1 c.78.1.1 PDB: 1akm_A* 2otc_A* Back     alignment and structure
>4h31_A Otcase, ornithine carbamoyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PE5; 1.70A {Vibrio vulnificus} PDB: 3upd_A* Back     alignment and structure
>3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>4ekn_B Aspartate carbamoyltransferase; atcase, aspartate transcarbamoylase, pyrimidine biosynthesis thermostability, substrate channeling; 2.50A {Methanocaldococcus jannaschii} PDB: 3e2p_A 2rgw_A Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>4ep1_A Otcase, ornithine carbamoyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; 3.25A {Bacillus anthracis} Back     alignment and structure
>3k5i_A Phosphoribosyl-aminoimidazole carboxylase; purine biosynthesis, ATP-grAsp, lyase; HET: NHE ADP AIR; 2.00A {Aspergillus clavatus} PDB: 3k5h_A* Back     alignment and structure
>2x5j_O E4PDH, D-erythrose-4-phosphate dehydrogenase; oxidoreductase, hydride transfer, aldehyde dehydrogenase, PY biosynthesis; 2.30A {Escherichia coli} PDB: 2xf8_A* 2x5k_O* Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* Back     alignment and structure
>3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A Back     alignment and structure
>1obb_A Maltase, alpha-glucosidase; glycosidase, sulfinic acid, NAD+, maltose, hydrolase; HET: MAL NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>3q98_A Transcarbamylase; rossmann fold, transferase; 2.00A {Escherichia coli} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Back     alignment and structure
>3b1j_A Glyceraldehyde 3-phosphate dehydrogenase (NADP+); alpha/beta fold, oxidoreductase-protein binding complex; HET: NAD; 2.20A {Synechococcus elongatus} PDB: 3b1k_A* 3b20_A* Back     alignment and structure
>3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>3fef_A Putative glucosidase LPLD; gulosidase, structural genomics, unknown function, glycosidase, hydrolase, manganese, metal-binding, NAD, PSI- 2; 2.20A {Bacillus subtilis} Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>3csu_A Protein (aspartate carbamoyltransferase); transferase (carbamoyl-P; 1.88A {Escherichia coli} SCOP: c.78.1.1 c.78.1.1 PDB: 1r0b_A* 1q95_A* 1raa_A* 1rab_A* 1rac_A* 1rad_A* 1rae_A* 1raf_A* 1rag_A* 1rah_A* 1rai_A* 1r0c_A* 1za2_A* 1za1_A* 2fzc_A* 2fzg_A* 2fzk_A* 2h3e_A* 2ipo_A* 2qg9_A ... Back     alignment and structure
>1gad_O D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehyde(D)-NAD+(A)); HET: NAD; 1.80A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1dc4_A* 1dc3_A 1dc6_A* 1dc5_A* 1s7c_A* 1gae_O* 2vyn_A* 2vyv_A* Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>1j5p_A Aspartate dehydrogenase; TM1643, structural genomics, JCSG, protein structure initiative, joint center for structural G oxidoreductase; HET: NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 PDB: 1h2h_A* Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>1v9l_A Glutamate dehydrogenase; protein-NAD complex, oxidoreductase; HET: NAD; 2.80A {Pyrobaculum islandicum} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>4fgw_A Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxidoreductase; 2.45A {Saccharomyces cerevisiae} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>2d2i_A Glyceraldehyde 3-phosphate dehydrogenase; rossmann fold, protein-NADP+ complex, oxidoreductase; HET: NAP; 2.50A {Synechococcus SP} PDB: 2duu_A Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>3tpf_A Otcase, ornithine carbamoyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, rossman fold; 2.70A {Campylobacter jejuni subsp} Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>4f2g_A Otcase 1, ornithine carbamoyltransferase 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>2ejw_A HDH, homoserine dehydrogenase; NAD-dependent, oxidoreductase; 1.70A {Thermus thermophilus} Back     alignment and structure
>3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>1rm4_O Glyceraldehyde 3-phosphate dehydrogenase A; rossmann fold, GAPDH-NADP complex, oxidoreductase; HET: NDP; 2.00A {Spinacia oleracea} SCOP: c.2.1.3 d.81.1.1 PDB: 1nbo_O* 2hki_A 2pkq_P* 1rm5_O* 1rm3_O* 2pkr_O* 1jn0_O* 3qv1_A* 3k2b_A* 3rvd_A* 2pkq_O* Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>3grf_A Ornithine carbamoyltransferase; ornithine transcarbamoylase, arginine degradation pathway, giardia lamblia, drug target; 2.00A {Giardia intestinalis} Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A* Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>3gd5_A Otcase, ornithine carbamoyltransferase; structural genomics, NYSGXRC, target 9454P, operon, amino-acid biosynthesis, ARGI biosynthesis; 2.10A {Gloeobacter violaceus} Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>2yfk_A Aspartate/ornithine carbamoyltransferase; transcarbamylase; 2.55A {Enterococcus faecalis} Back     alignment and structure
>1js1_X Transcarbamylase; alpha/beta topology, two domains, transferase; 2.00A {Bacteroides fragilis} SCOP: c.78.1.1 c.78.1.1 PDB: 2fg6_X* 2fg7_X* 2g7m_X* Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1 Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>2yfq_A Padgh, NAD-GDH, NAD-specific glutamate dehydrogenase; oxidoreductase; 2.94A {Peptoniphilus asaccharolyticus} Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} Back     alignment and structure
>1s6y_A 6-phospho-beta-glucosidase; hydrolase, structural genomics, PSI, protein structure initi midwest center for structural genomics; 2.31A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>4hv4_A UDP-N-acetylmuramate--L-alanine ligase; MURC, yersinia pestis peptidoglycan synthesis; HET: AMP; 2.25A {Yersinia pestis} PDB: 2f00_A Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} Back     alignment and structure
>4a8t_A Putrescine carbamoyltransferase; trabnsferase PALO, delta-N-(phosphonoacetyl)-L- ornithine, agmatine deiminase route, agmatine catabolism; HET: PAO PGE; 1.59A {Enterococcus faecalis} Back     alignment and structure
>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>3k92_A NAD-GDH, NAD-specific glutamate dehydrogenase; ROCG, oxidoreductase; 2.30A {Bacillus subtilis} PDB: 3k8z_A Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Back     alignment and structure
>1u8x_X Maltose-6'-phosphate glucosidase; structural genomics, PSI, protein structure initiative, MCSG glucosidase, NAD-dependent; HET: G6P NAD; 2.05A {Bacillus subtilis} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 244
d1gdha2129 c.23.12.1 (A:2-100,A:292-321) D-glycerate dehydrog 1e-15
d1dxya2131 c.23.12.1 (A:1-100,A:300-330) D-2-hydroxyisocaproa 3e-15
d1ygya2130 c.23.12.1 (A:3-98,A:283-316) Phosphoglycerate dehy 5e-14
d1gdha1191 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyp 6e-14
d1j4aa2134 c.23.12.1 (A:2-103,A:301-332) D-lactate dehydrogen 3e-12
d1mx3a2133 c.23.12.1 (A:27-125,A:319-352) Transcription corep 6e-11
d2naca2186 c.23.12.1 (A:1-147,A:336-374) Formate dehydrogenas 1e-08
d1mx3a1193 c.2.1.4 (A:126-318) Transcription corepressor CtbP 4e-08
d1sc6a2132 c.23.12.1 (A:7-107,A:296-326) Phosphoglycerate deh 7e-08
d1ygya1184 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase 7e-07
d1qp8a2121 c.23.12.1 (A:1-82,A:264-302) Putative formate dehy 2e-06
d1j4aa1197 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lacto 1e-05
d2naca1188 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudom 3e-05
d1qp8a1181 c.2.1.4 (A:83-263) Putative formate dehydrogenase 3e-05
d1dxya1199 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydro 1e-04
d1sc6a1188 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase 2e-04
d1b7go1178 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosp 0.003
>d1gdha2 c.23.12.1 (A:2-100,A:292-321) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Length = 129 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Formate/glycerate dehydrogenase catalytic domain-like
family: Formate/glycerate dehydrogenases, substrate-binding domain
domain: D-glycerate dehydrogenase
species: Hyphomicrobium methylovorum [TaxId: 84]
 Score = 68.9 bits (168), Expect = 1e-15
 Identities = 24/128 (18%), Positives = 53/128 (41%), Gaps = 5/128 (3%)

Query: 15  KYRVVSTKPMPGTRWINLLIEQDCRVEICTQKKTILSVEDIIALIGDKCDGVIGQLTEDW 74
           K +++ T P+P    +     +   V         ++++++I       D ++  L E  
Sbjct: 1   KKKILITWPLP-EAAMARA-RESYDVIA-HGDDPKITIDEMIETAKS-VDALLITLNEKC 56

Query: 75  GETLFAALSRAGGKAFSNMAVGYNNVDVNAANKYGIAVGNTPGVLTETTAELAASLSLAA 134
            + +   +     K  S  ++G++++D++A    GI VGN P   T+   ++A   +   
Sbjct: 57  RKEVIDRIPE-NIKCISTYSIGFDHIDLDACKARGIKVGNAPHGATQAREDMAHQANDLI 115

Query: 135 ARRIVEAD 142
                 AD
Sbjct: 116 DALFGGAD 123


>d1dxya2 c.23.12.1 (A:1-100,A:300-330) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Length = 131 Back     information, alignment and structure
>d1ygya2 c.23.12.1 (A:3-98,A:283-316) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 130 Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Length = 191 Back     information, alignment and structure
>d1j4aa2 c.23.12.1 (A:2-103,A:301-332) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Length = 134 Back     information, alignment and structure
>d1mx3a2 c.23.12.1 (A:27-125,A:319-352) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d2naca2 c.23.12.1 (A:1-147,A:336-374) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Length = 186 Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Length = 193 Back     information, alignment and structure
>d1sc6a2 c.23.12.1 (A:7-107,A:296-326) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Length = 132 Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 184 Back     information, alignment and structure
>d1qp8a2 c.23.12.1 (A:1-82,A:264-302) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 121 Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Length = 197 Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Length = 188 Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 181 Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Length = 199 Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Length = 188 Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 178 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query244
d1ygya2130 Phosphoglycerate dehydrogenase {Mycobacterium tube 99.94
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 99.92
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 99.92
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 99.92
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 99.91
d1qp8a2121 Putative formate dehydrogenase {Archaeon Pyrobacul 99.91
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 99.9
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 99.9
d1sc6a2132 Phosphoglycerate dehydrogenase {Escherichia coli [ 99.89
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 99.89
d1dxya2131 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 99.89
d1gdha2129 D-glycerate dehydrogenase {Hyphomicrobium methylov 99.88
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 99.88
d2naca2186 Formate dehydrogenase {Pseudomonas sp., strain 101 99.85
d1mx3a2133 Transcription corepressor CtbP {Human (Homo sapien 99.84
d1j4aa2134 D-lactate dehydrogenase {Lactobacillus helveticus 99.83
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 99.26
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 98.77
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 98.49
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 98.35
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 98.32
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 98.31
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 98.29
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 98.28
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 98.28
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 98.18
d1bg6a2 184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 98.06
d1c1da1 201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 98.05
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 97.97
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 97.94
d2pgda2 176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 97.89
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 97.86
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 97.74
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 97.7
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 97.59
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 97.51
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 97.48
d1leha1 230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 97.41
d1f06a1 170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 97.4
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 97.35
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 97.34
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 97.3
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 97.27
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 97.25
d1txga2 180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 97.24
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 97.24
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 97.22
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 97.16
d1mv8a2 202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 97.15
d1n1ea2 189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 97.14
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 97.11
d1x7da_ 340 Ornithine cyclodeaminase {Pseudomonas putida [TaxI 97.1
d1e5qa1 182 Saccharopine reductase {Rice blast fungus (Magnapo 97.08
d1ydwa1 184 Probable oxidoreductase At4g09670 {Thale cress (Ar 97.04
d1b26a1 234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 96.95
d1hdoa_ 205 Biliverdin IX beta reductase {Human (Homo sapiens) 96.91
d1np3a2 182 Class I ketol-acid reductoisomerase (KARI) {Pseudo 96.84
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 96.84
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 96.83
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 96.82
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 96.76
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 96.73
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.73
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 96.72
d1dlja2 196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 96.72
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 96.69
d1zh8a1 181 Hypothetical protein TM0312 {Thermotoga maritima [ 96.66
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 96.65
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 96.65
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 96.64
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 96.63
d1h6da1 221 Glucose-fructose oxidoreductase, N-terminal domain 96.63
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.61
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 96.6
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 96.56
d1v9la1 242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 96.56
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 96.54
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 96.54
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 96.51
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 96.51
d1jaya_ 212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 96.49
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 96.44
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 96.44
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 96.43
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 96.42
d1gtma1 239 Glutamate dehydrogenase {Archaeon Pyrococcus furio 96.41
d1dlja3108 UDP-glucose dehydrogenase (UDPGDH), C-terminal (UD 96.39
d1hwxa1 293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 96.36
d1g0oa_ 272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 96.31
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 96.3
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 96.2
d1wdka3 186 Fatty oxidation complex alpha subunit, middle doma 96.2
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 96.15
d1qmga2 226 Class II ketol-acid reductoisomerase (KARI) {Spina 96.13
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 96.06
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 96.05
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 96.03
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 95.97
d1geea_ 261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 95.94
d1mv8a3136 GDP-mannose 6-dehydrogenase, GDP-binding domain {P 95.92
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 95.89
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 95.89
d1ml4a2157 Aspartate carbamoyltransferase catalytic subunit { 95.89
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 95.84
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 95.82
d1yb1a_ 244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 95.82
d1vlva2161 Ornithine transcarbamoylase {Thermotoga maritima [ 95.8
d1w6ua_ 294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 95.76
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 95.67
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 95.65
d1omoa_ 320 Archaeal alanine dehydrogenase {Archaeon Archaeogl 95.57
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 95.57
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 95.56
d1bgva1 255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 95.55
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 95.53
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 95.4
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 95.39
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 95.39
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 95.35
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 95.34
d1vl8a_ 251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 95.31
d1vjta1 193 Putative alpha-glucosidase TM0752 {Thermotoga mari 95.3
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 95.25
d1x1ta1 260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 95.21
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 95.19
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 95.19
d2h7ma1 268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 95.19
d1zema1 260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 95.19
d1ae1a_ 258 Tropinone reductase {Jimsonweed (Datura stramonium 95.17
d1dxha2 185 Ornithine transcarbamoylase {Pseudomonas aeruginos 95.12
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 95.11
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 95.1
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 95.1
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 95.08
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 95.06
d1pvva2163 Ornithine transcarbamoylase {Archaeon Pyrococcus f 95.05
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 95.02
d1ulua_ 256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 95.02
d1otha2170 Ornithine transcarbamoylase {Human (Homo sapiens) 94.99
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 94.92
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 94.87
d2pd4a1 274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 94.86
d1ydea1 250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 94.85
d1xkqa_ 272 Hypothetical protein R05D8.7 {Caenorhabditis elega 94.83
d1pg5a2153 Aspartate carbamoyltransferase catalytic subunit { 94.83
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 94.81
d2o23a1 248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 94.71
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 94.69
d1lc0a1172 Biliverdin reductase {Rat (Rattus norvegicus) [Tax 94.64
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 94.62
d1h5qa_ 260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 94.5
d1o5ia_ 234 beta-keto acyl carrier protein reductase {Thermoto 94.49
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 94.48
d2q46a1 252 Hypothetical protein At5g02240 (T7H20_290) {Thale 94.44
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 94.43
d1xg5a_ 257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 94.39
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 94.35
d1xq1a_ 259 Tropinone reductase {Thale cress (Arabidopsis thal 94.35
d1xhla_ 274 Hypothetical protein F25D1.5 {Caenorhabditis elega 94.31
d2ae2a_ 259 Tropinone reductase {Jimsonweed (Datura stramonium 94.27
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 94.26
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 94.23
d2ew8a1 247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 94.15
d1ja9a_ 259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 94.12
d2c07a1 251 beta-keto acyl carrier protein reductase {Malaria 94.11
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 94.11
d1gtea4 196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 94.08
d1gado1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 94.0
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 93.89
d1xu9a_ 269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 93.85
d2at2a2151 Aspartate carbamoyltransferase catalytic subunit { 93.85
d1duvg2 183 Ornithine transcarbamoylase {Escherichia coli [Tax 93.81
d1hdca_ 254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 93.79
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 93.79
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 93.79
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 93.76
d1pr9a_ 244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 93.75
d1fcda1 186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 93.73
d1cyda_ 242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 93.7
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 93.64
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 93.61
d2nvwa1 237 Galactose/lactose metabolism regulatory protein GA 93.51
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 93.46
d2a4ka1 241 beta-keto acyl carrier protein reductase {Thermus 93.42
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 93.4
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 93.38
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 93.38
d1sbya1 254 Drosophila alcohol dehydrogenase {Fly (Drosophila 93.35
d2bkaa1 232 TAT-interacting protein TIP30 {Human (Homo sapiens 93.27
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 93.18
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 93.17
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 93.11
d1fmca_ 255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 93.04
d1iy8a_ 258 Levodione reductase {Corynebacterium aquaticum [Ta 93.0
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 92.99
d1uzma1 237 beta-keto acyl carrier protein reductase {Mycobact 92.95
d1qyda_ 312 Pinoresinol-lariciresinol reductase {Giant arborvi 92.93
d1dssg1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 92.92
d1d7oa_ 297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 92.81
d1ulsa_ 242 beta-keto acyl carrier protein reductase {Thermus 92.79
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 92.78
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 92.69
d1rm4a1172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 92.64
d1hdgo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 92.64
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 92.6
d1q7ba_ 243 beta-keto acyl carrier protein reductase {Escheric 92.55
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 92.54
d7reqa2168 Methylmalonyl-CoA mutase alpha subunit, C-terminal 92.51
d1u8fo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 92.49
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 92.31
d1qsga_ 258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 92.29
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 92.13
d2csua1129 Acetate-CoA ligase alpha chain, AcdA, N-terminal d 92.11
d1nffa_ 244 Putative oxidoreductase Rv2002 {Mycobacterium tube 92.11
d1id1a_153 Rck domain from putative potassium channel Kch {Es 92.06
d2g82a1168 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 92.01
d1qyca_ 307 Phenylcoumaran benzylic ether reductase {Loblolly 91.94
d3cmco1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 91.92
d1wmaa1 275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 91.89
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 91.72
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 91.65
d2bgka1 268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 91.63
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 91.63
d2b69a1 312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 91.6
d1ekxa2160 Aspartate carbamoyltransferase catalytic subunit { 91.54
d1jw9b_ 247 Molybdenum cofactor biosynthesis protein MoeB {Esc 91.48
d1yxma1 297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 91.46
d2b4ro1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 91.37
d1k2wa_ 256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 91.35
d1obfo1173 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 91.31
d2h1qa1251 Hypothetical protein Dhaf_3308 {Desulfitobacterium 91.1
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 91.1
d1hxha_ 253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 90.96
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 90.9
d1bdba_ 276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 90.79
d2rhca1 257 beta-keto acyl carrier protein reductase {Streptom 90.74
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 90.66
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 90.6
d1zk4a1 251 R-specific alcohol dehydrogenase {Lactobacillus br 90.6
d2d1ya1 248 Hypothetical protein TTHA0369 {Thermus thermophilu 90.59
d1dhra_ 236 Dihydropteridin reductase (pteridine reductase) {R 90.55
d2gdza1 254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 90.45
d2ag5a1 245 Dehydrogenase/reductase SDR family member 6, DHRS6 90.38
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 90.23
d1y1pa1 342 Aldehyde reductase II {Sporobolomyces salmonicolor 90.04
d2g17a1179 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 90.0
d1djqa3 233 Trimethylamine dehydrogenase, middle domain {Methy 89.83
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 89.8
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 89.52
d1db3a_ 357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 89.52
d1k3ta1 190 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 89.41
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 89.33
d2a35a1 212 Hypothetical protein PA4017 {Pseudomonas aeruginos 89.1
d1cjca2 230 Adrenodoxin reductase of mitochondrial p450 system 89.09
d2voua1 265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 89.05
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 88.78
d1iuka_136 Hypothetical protein TT1466 {Thermus thermophilus 88.68
d1vkna1 176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 88.5
d1gega_ 255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 88.41
d1gz6a_ 302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 88.32
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 88.1
d1vl6a1 222 Malate oxidoreductase (malic enzyme) {Thermotoga m 88.03
d2bi7a1 314 UDP-galactopyranose mutase, N-terminal domain {Kle 88.0
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 87.94
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 87.92
d1vl0a_ 281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 87.57
d1tuga1310 Aspartate carbamoyltransferase catalytic subunit { 87.39
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 87.31
d2c5aa1 363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 87.31
d1q1ra1 185 Putidaredoxin reductase {Pseudomonas putida [TaxId 87.29
d1spxa_ 264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 87.13
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 87.04
d1c0pa1 268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 87.02
d1wd7a_254 Probable uroporphyrinogen-III synthase {Thermus th 86.98
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 86.9
d1ebfa1168 Homoserine dehydrogenase {Baker's yeast (Saccharom 86.46
d1oaaa_ 259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 86.16
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 85.68
d1jr2a_260 Uroporphyrinogen III synthase (U3S, HemD) {Human ( 85.11
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 84.83
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 84.3
d1uaya_ 241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 84.19
d2gv8a1 335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 83.96
d1fjha_ 257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 83.94
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 83.57
d2ivda1 347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 83.15
d1yovb1 426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 83.13
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 83.07
d1rp0a1 278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 82.64
d1trba1 190 Thioredoxin reductase {Escherichia coli [TaxId: 56 82.48
d1gesa1 217 Glutathione reductase {Escherichia coli [TaxId: 56 82.13
d2cvoa1 183 Putative semialdehyde dehydrogenase {Rice (Oryza s 82.08
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 81.63
d2bcgg1 297 Guanine nucleotide dissociation inhibitor, GDI {Ba 81.63
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 81.63
d2fr1a1 259 Erythromycin synthase, eryAI, 1st ketoreductase mo 81.36
d1k0ia1 292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 81.3
d1rpna_ 321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 81.0
d1z45a2 347 Uridine diphosphogalactose-4-epimerase (UDP-galact 80.93
d1udca_ 338 Uridine diphosphogalactose-4-epimerase (UDP-galact 80.71
d1b5qa1 347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 80.51
d1edoa_ 244 beta-keto acyl carrier protein reductase {Oil seed 80.44
d1w4xa2 235 Phenylacetone monooxygenase {Thermobifida fusca [T 80.12
>d1ygya2 c.23.12.1 (A:3-98,A:283-316) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Formate/glycerate dehydrogenase catalytic domain-like
family: Formate/glycerate dehydrogenases, substrate-binding domain
domain: Phosphoglycerate dehydrogenase
species: Mycobacterium tuberculosis [TaxId: 1773]
Probab=99.94  E-value=2.5e-27  Score=180.45  Aligned_cols=129  Identities=22%  Similarity=0.274  Sum_probs=115.0

Q ss_pred             CCeEEEEeCCCCchHHHHHHHhCCCeEEEeccCCCCCCHHHHHHHhcCCccEEEeccCccccHHHHHHhhccCCcEEEEc
Q 026023           14 GKYRVVSTKPMPGTRWINLLIEQDCRVEICTQKKTILSVEDIIALIGDKCDGVIGQLTEDWGETLFAALSRAGGKAFSNM   93 (244)
Q Consensus        14 ~~~~ilv~~~~~~~~~~~~l~~~~~~v~~~~~~~~~~~~~~~~~~~~~~ad~ii~~~~~~~~~~~l~~~p~l~~k~I~~~   93 (244)
                      +|+|||++.++++. ..+.|++. +++++...    .+++++.+.+++ +|++++....++++++++.+|+|  |+|++.
T Consensus         1 sMpkvli~~~~~~~-~~~~L~~~-~~v~~~~~----~~~~el~~~~~~-~d~ii~~~~~~i~~~~l~~~p~L--k~I~~~   71 (130)
T d1ygya2           1 SLPVVLIADKLAPS-TVAALGDQ-VEVRWVDG----PDRDKLLAAVPE-ADALLVRSATTVDAEVLAAAPKL--KIVARA   71 (130)
T ss_dssp             CCCEEEECSSCCGG-GGTTSCSS-SEEEECCT----TSHHHHHHHGGG-CSEEEECSSSCBCHHHHHTCTTC--CEEEES
T ss_pred             CCCEEEEECCCCHH-HHHHHhCC-cEEEECCC----CCHHHHHHHcCC-CEEEEEcCcccchHHHHhhcccc--eEEeee
Confidence            48899999998876 46777665 68876543    478999999985 99999877778999999999999  999999


Q ss_pred             ccCCCccChHHHhhCCcEEEecCCCCCcchHHHHHHHHHHHHhChHHHHHHHHcCCCC
Q 026023           94 AVGYNNVDVNAANKYGIAVGNTPGVLTETTAELAASLSLAAARRIVEADEFMRAGLYD  151 (244)
Q Consensus        94 ~aG~d~id~~~~~~~gI~v~n~~~~~~~~vAE~~l~~~L~~~R~~~~~~~~~~~~~w~  151 (244)
                      |+|+||||+++|+++||.|+|+|++++.+|||++++++|++.|++..+.+.+|+|.|-
T Consensus        72 g~G~d~IDl~~~~~~gI~V~n~p~~~~~~VAE~~~~l~L~l~R~i~~a~~~vr~g~~~  129 (130)
T d1ygya2          72 GVGLDNVDVDAATARGVLVVNAPTSASTAEAQDRAGTDVAESVRLALAGEFVPDAVNV  129 (130)
T ss_dssp             SSCCTTBCHHHHHHTTCEEECCTTSSCBHHHHHHHHHHHHHHHHHHHTTCCCTTBCSC
T ss_pred             cccccchhHHHHHHCCceEEecCCCCcHHHHHHHHHHHHHHHhhHHHHhhhcccCccC
Confidence            9999999999999999999999999999999999999999999999988888888763



>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qp8a2 c.23.12.1 (A:1-82,A:264-302) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1sc6a2 c.23.12.1 (A:7-107,A:296-326) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxya2 c.23.12.1 (A:1-100,A:300-330) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1gdha2 c.23.12.1 (A:2-100,A:292-321) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d2naca2 c.23.12.1 (A:1-147,A:336-374) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1mx3a2 c.23.12.1 (A:27-125,A:319-352) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1j4aa2 c.23.12.1 (A:2-103,A:301-332) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1dlja3 c.26.3.1 (A:295-402) UDP-glucose dehydrogenase (UDPGDH), C-terminal (UDP-binding) domain {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1qmga2 c.2.1.6 (A:82-307) Class II ketol-acid reductoisomerase (KARI) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1mv8a3 c.26.3.1 (A:301-436) GDP-mannose 6-dehydrogenase, GDP-binding domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ml4a2 c.78.1.1 (A:152-308) Aspartate carbamoyltransferase catalytic subunit {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vlva2 c.78.1.1 (A:153-313) Ornithine transcarbamoylase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1dxha2 c.78.1.1 (A:151-335) Ornithine transcarbamoylase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1pvva2 c.78.1.1 (A:151-313) Ornithine transcarbamoylase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1otha2 c.78.1.1 (A:185-354) Ornithine transcarbamoylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1pg5a2 c.78.1.1 (A:147-299) Aspartate carbamoyltransferase catalytic subunit {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2at2a2 c.78.1.1 (A:145-295) Aspartate carbamoyltransferase catalytic subunit {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1duvg2 c.78.1.1 (G:151-333) Ornithine transcarbamoylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rm4a1 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1hdgo1 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d7reqa2 c.23.6.1 (A:561-728) Methylmalonyl-CoA mutase alpha subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d3cmco1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ekxa2 c.78.1.1 (A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b4ro1 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d2h1qa1 c.67.3.1 (A:1-251) Hypothetical protein Dhaf_3308 {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k3ta1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1tuga1 c.78.1.1 (A:1-150,A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1wd7a_ c.113.1.1 (A:) Probable uroporphyrinogen-III synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ebfa1 c.2.1.3 (A:2-150,A:341-359) Homoserine dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jr2a_ c.113.1.1 (A:) Uroporphyrinogen III synthase (U3S, HemD) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure