Citrus Sinensis ID: 026025


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240----
MGELAADKHVKYIISVEKKKDSFESVVMEHLRLNGAYWGLTTLDILGKLDAVDEEDVISWILKCQDESGGFAGNIGHDPHVLYTLSAVQVLALFDKVDILDADKVSNYIVGLQNEDGSFSGDIWGEVDTRFSYIAICCLSILQRLDKINVDKAVEYIVSCKNLDGGFGCTPGGESHSGQIFCCVGALAIAGALHHVDKDLLGWWLCERQVKSGGLNGRPEKLPDVGIFSQPNLMMEHSCRSSSQ
ccHHHHHHHHHHHHHHHccccccccHHcccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHcccccccccccccccccccccccHHHHHccccccccc
MGELAADKHVKYIISVEKKKDSFESVVMEHLRLNGAYWGLTTLDILGKLDAVDEEDVISWILKCQDESGGFAGNIGHDPHVLYTLSAVQVLALFDKVDILDADKVSNYIVGLQNEDGSFSGDIWGEVDTRFSYIAICCLSILQRLDKINVDKAVEYIVSCKNLDGGFGCTPGGESHSGQIFCCVGALAIAGALHHVDKDLLGWWLCERQVKSGGLNGRPEKLPDVGIFSQPNLM**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGELAADKHVKYIISVEKKKDSFESVVMEHLRLNGAYWGLTTLDILGKLDAVDEEDVISWILKCQDESGGFAGNIGHDPHVLYTLSAVQVLALFDKVDILDADKVSNYIVGLQNEDGSFSGDIWGEVDTRFSYIAICCLSILQRLDKINVDKAVEYIVSCKNLDGGFGCTPGGESHSGQIFCCVGALAIAGALHHVDKDLLGWWLCERQVKSGGLNGRPEKLPDVGIFSQPNLMMEHSCRSSSQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Geranylgeranyl transferase type-2 subunit beta Catalyzes the transfer of a geranyl-geranyl moiety from geranyl-geranyl pyrophosphate to both cysteines in Rab proteins with an -XXCC, -XCXC and -CCXX C-terminal, such as RAB1A, RAB3A and RAB5A respectively.probableQ08603
Geranylgeranyl transferase type-2 subunit beta Catalyzes the transfer of a geranyl-geranyl moiety from geranyl-geranyl pyrophosphate to proteins having the C-terminal -XCC or -XCXC, where both cysteines may become modified. Acts on YPT1 and SEC4.probableP20133
Geranylgeranyl transferase type-2 subunit beta Catalyzes the transfer of a geranyl-geranyl moiety from geranyl-geranyl pyrophosphate to proteins having the C-terminal -XCC or -XCXC, where both cysteines may become modified.probableP46960

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.5.-.-Transferring alkyl or aryl groups, other than methyl groups.probable
2.5.1.-5,10-methenyltetrahydromethanopterin hydrogenase.probable
2.5.1.60Protein geranylgeranyltransferase type II.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DSS, chain B
Confidence level:very confident
Coverage over the Query: 2-240
View the alignment between query and template
View the model in PyMOL