Citrus Sinensis ID: 026027

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240----

MAEVEAKAPVPESVLKKQKRNEEWALAKKQELETSKKNKLESRKLIYNRAKQYAKEFAEQEKVLIQLKREAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVFLKVNKATMNMLHRVEPYVTYGYPNLKSVRELIYKRGYGKLDKQRIALTDNSIIEKALGKFGIICMEDLIHEIMTVGPHFKEANNFLWPFKLKAPLGGLKKKRNHYVEGGDAGNRENYVNELIRRMN

cccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEEccccccccHHHHHHHHccccccEEEEEEcccHHHHHHHHHcccccccccccHHHHHHHHHHHccccccccccccccHHHHHHHHHccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHc

******K***PESVLKKQKRNEEWALA*****************LIYNRAKQYAKEFAEQEKVLIQLKREAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVFLKVNKATMNMLHRVEPYVTYGYPNLKSVRELIYKRGYGKLDKQRIALTDNSIIEKALGKFGIICMEDLIHEIMTVGPHFKEANNFLWPFKLKAPLGGLKKKRNHYVEGGDAGNRENYVNELIRRMN

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MAEVEAKAPVPESVLKKQKRNEEWALAKKQELETSKKNKLESRKLIYNRxxxxxxxxxxxxxxxxxxxxxAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVFLKVNKATMNMLHRVEPYVTYGYPNLKSVRELIYKRGYGKLDKQRIALTDNSIIEKALGKFGIICMEDLIHEIMTVGPHFKEANNFLWPFKLKAPLGGLKKKRNHYVEGGDAGNRENYVNELIRRMN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
60S ribosomal protein L7-4		confident	Q9LHP1
60S ribosomal protein L7-A		probable	P05737
60S ribosomal protein L7	Binds to G-rich structures in 28S rRNA and in mRNAs. Plays a regulatory role in the translation apparatus; inhibits cell-free translation of mRNAs.	probable	Q5R9R4

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZKR, chain w
Confidence level:very confident
Coverage over the Query: 85-244
View the alignment between query and template
View the model in PyMOL