Citrus Sinensis ID: 026039

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240----

MGPVKAAAGDLVLTFMWVFVSSTFGVLTTEIASALGVHGLVWPPMLITTAIVFVFVFIFNIIGDALGGASFNPTGTAAFYAVGVGSDSLLSMALRFPAQAAGAVGGALAIMEYMPPKYKHMLGGPSLQVDLHTGAIAEGVLTFLITFAVLVIMLKGPQSNILKTWLVAVATVVLIVTGSAYTGPSMNPANAFGWAYVNKWHDTWDQFYVYWICPFIGAVAASMIFRVVFPPPAPARPAKKKKKN

ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHEEEEcccccccHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHccccccccccEEEEccHHHHHHHHHHHHHHHcccccccccccccccc

*GPVKAAAGDLVLTFMWVFVSSTFGVLTTEIASALGVHGLVWPPMLITTAIVFVFVFIFNIIGDALGGASFNPTGTAAFYAVGVGSDSLLSMALRFPAQAAGAVGGALAIMEYMPPKYKHMLGGPSLQVDLHTGAIAEGVLTFLITFAVLVIMLKGPQSNILKTWLVAVATVVLIVTGSAYTGPSMNPANAFGWAYVNKWHDTWDQFYVYWICPFIGAVAASMIFRVVF***************

xxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Aquaporin SIP1-1	Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.	probable	Q5VR89
Probable aquaporin SIP1-2	Water channel required to facilitate the transport of water across cell membrane.	probable	Q9FK43
Aquaporin SIP1-2	Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.	probable	Q9ATM2

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3IYZ, chain A
Confidence level:very confident
Coverage over the Query: 2-230
View the alignment between query and template
View the model in PyMOL