Citrus Sinensis ID: 026045

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240----

MAQAVEDWYKQMPIITRTYLTAAIVTTVGCSLDIISPFNLCLHPTLVVKHYQFWRLITNFLFFRKMDLDFLFHMFFLARYCKLLEENSFRGRTADFLYMLLFGATFLTGTVLIGGMIPYLSESFAKIIFLSNSLTLMMVYVWSKQNPFIHMSFLGLFTFTAAYLPWVLLGFSVFVGASAWVDLLGMIAGHAYYFLEDVYPRMTGRRPLKTPSFIKALFADEAVVVARPANVRFAPPPAEEVHQD

ccHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccccEEECHHHHHHHcccccEEEEEEEcccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHcccccccccccccccccccccccccc

**QAVEDWYKQMPIITRTYLTAAIVTTVGCSLDIISPFNLCLHPTLVVKHYQFWRLITNFLFFRKMDLDFLFHMFFLARYCKLLEENSFRGRTADFLYMLLFGATFLTGTVLIGGMIPYLSESFAKIIFLSNSLTLMMVYVWSKQNPFIHMSFLGLFTFTAAYLPWVLLGFSVFVGASAWVDLLGMIAGHAYYFLEDVYPRMTGRRPLKTPSFIKALFADEAV*********************

xxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Derlin-2	May be involved in the degradation process of specific misfolded endoplasmic reticulum (ER) luminal proteins.	confident	Q851X7
Derlin-2.2	May be involved in the degradation process of specific misfolded endoplasmic reticulum (ER) luminal proteins.	confident	Q9ZS88
Derlin-2.1	May be involved in the degradation process of specific misfolded endoplasmic reticulum (ER) luminal proteins.	probable	Q4G2J4

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2NR9, chain A
Confidence level:confident
Coverage over the Query: 10-196
View the alignment between query and template
View the model in PyMOL