Citrus Sinensis ID: 026056


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240----
MDLIFSHSPSSYITLILLLFCKGLSGATFTMVNRCSYAVWPGILGNAKLDSTGFELTPGSSRSVQVPPTWSGRFWGRTGCTFDPTTGQGSCTTGDCGSNQIECNGLTAKPPATLAEFTTGSGTQDFYDVSLVDGYNLPMIVEPIGGSGTCLSTGCVTDLNQRCPAELRDQSGEGCKSACEAFGNPEYCCSGAYATPSTCKPSVYSEMFKSACPRSYSYAYDDATSTFTCTGADYTITFCPSVTR
ccccccHHHHHHHHHHHHHHHHcccEEEEEEEEcccccEEccCCccccccccccECccccEEEEEccccccccEEccccccccccccccccccccccccccccccccccccccEEEEEEccccccEEEcccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccEEEccccEEEEEcccccc
*********SSYITLILLLFCKGLSGATFTMVNRCSYAVWPGILGNAKLDSTGFELTPGSSRSVQVPPTWSGRFWGRTGCTFDPTTGQGSCTTGDCGSNQIECNGLTAKPPATLAEFTTGSGTQDFYDVSLVDGYNLPMIVEPIGGSGTCLSTGCVTDLNQRCPAELRDQSGEGCKSACEAFGNPEYCCSGAYATPSTCKPSVYSEMFKSACPRSYSYAYDDATSTFTCTGADYTITFCPS***
xxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDLIFSHSPSSYITLILLLFCKGLSGATFTMVNRCSYAVWPGILGNAKLDSTGFELTPGSSRSVQVPPTWSGRFWGRTGCTFDPTTGQGSCTTGDCGSNQIECNGLTAKPPATLAEFTTGSGTQDFYDVSLVDGYNLPMIVEPIGGSGTCLSTGCVTDLNQRCPAELRDQSGEGCKSACEAFGNPEYCCSGAYATPSTCKPSVYSEMFKSACPRSYSYAYDDATSTFTCTGADYTITFCPSVTR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Thaumatin-like protein 1 probableO80327
Thaumatin-like protein 1a probableQ9FSG7
Glucan endo-1,3-beta-glucosidase probableP50694

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2AHN, chain A
Confidence level:very confident
Coverage over the Query: 27-240
View the alignment between query and template
View the model in PyMOL