Citrus Sinensis ID: 026057

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240----
MKCRRPTCTDYIISLNCDDVSKGSSTYIGRLRSNFLGTKFTIYDGHPPNAEARVTKCRSTRQVNMKQVSPKLLAGNYHVAHISYELNVLGSRGPRRMQCVMDAIPASSIEPGGVAPTQTEFHHSGLDSFPSIPFFRSKSIRAENFQNDQKEGLLVLRNKAPRWHEQLQCWCLNFNGRVTVASVKNFQLVASLENGVAGQEHENVILQFGKVGKDVFTMDYQYPISAFQAFAICLSSFDTKIACE
cccccccccEEEEECccccccccccccCEEEcccccccEEEEEcccccccccccccccccccccccccccccccccEEEEEEEEEEEccccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccccccccEEEEccccEEEcccccEEEEEEccccccccccccEEEEEEEEcccEEEEEccccccHHHHHHHHHHccccccccc
******TCTDYIISLNCDDVSKGSSTYIGRLRSNFLGTKFTIYDGHP*****************MKQVSPKLLAGNYHVAHISYELNVLGSRGPRRMQCVMDAI*********************************************KEGLLVLRNKAPRWHEQLQCWCLNFNGRVTVASVKNFQLVASLENGVAGQEHENVILQFGKVGKDVFTMDYQYPISAFQAFAICLSSFDTKIACE
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKCRRPTCTDYIISLNCDDVSKGSSTYIGRLRSNFLGTKFTIYDGHPPNAEARVTKCRSTRQVNMKQVSPKLLAGNYHVAHISYELNVLGSRGPRRMQCVMDAIPASSIEPGGVAPTQTEFHHSGLDSFPSIPFFRSKSIRAENFQNDQKEGLLVLRNKAPRWHEQLQCWCLNFNGRVTVASVKNFQLVASLENGVAGQEHENVILQFGKVGKDVFTMDYQYPISAFQAFAICLSSFDTKIACE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Tubby-like F-box protein 3 probableQ8VY21

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2FIM, chain A
Confidence level:very confident
Coverage over the Query: 1-52,68-136,147-238
View the alignment between query and template
View the model in PyMOL
Template: 1I7E, chain A
Confidence level:confident
Coverage over the Query: 10-62,78-126,143-241
View the alignment between query and template
View the model in PyMOL