Citrus Sinensis ID: 026059

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240----
MFNSCDVLRPYVAHIDDIFKDFTSYKVRVPVTGAIILDETYERCILVKGWKGSSWSFPRGKKNKDEEDHACAIREVQEETGFDVSKLLNKDEFIEKIFGQQRVRLYIIAGVRDDTAFAPQTKKEISEIAWQRLDELQPASDDVISHGVTGLKLYMVAPFLASLKKWISAHKPSIAPKHDMPLKGVCVWKAKNNSIGSNTIALESQLTKVASDSQPPDTGPGKSFRNFRFDTAAILQAMEAGFCN
ccccccccccccccHHHHHHHHHHccccCEEEEEEEEcccccEEEEEECccccccccccccccccccHHHHHHHHHHHHccccccccccccEEEEEEEccEEEEEEEEEECcccccccccccccccEEEEEEcccccccccccccccccccEEEEEHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccc
MFNSCDVLRPYVAHIDDIFKDFTSYKVRVPVTGAIILDETYERCILVKGWKGSSWSFPRGKKNKDEEDHACAIREVQEETGFDVSKLLNKDEFIEKIFGQQRVRLYIIAGVRDDTAFAPQTKKEISEIAWQRLDELQPASDDVISHGVTGLKLYMVAPFLASLKKWISAHK*******************************************************FRFDTAAILQAME*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFNSCDVLRPYVAHIDDIFKDFTSYKVRVPVTGAIILDETYERCILVKGWKGSSWSFPRGKKNKDEEDHACAIREVQEETGFDVSKLLNKDEFIEKIFGQQRVRLYIIAGVRDDTAFAPQTKKEISEIAWQRLDELQPASDDVISHGVTGLKLYMVAPFLASLKKWISAHKPSIAPKHDMPLKGVCVWKAKNNSIGSNTIALESQLTKVASDSQPPDTGPGKSFRNFRFDTAAILQAMEAGFCN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
mRNA-decapping enzyme subunit 2 Catalytic component of the decapping complex necessary for the degradation of mRNAs, both in normal mRNA turnover and in nonsense-mediated mRNA decay. Removes the 7-methyl guanine cap structure from mRNA molecules, yielding a 5'-phosphorylated mRNA fragment and 7m-GDP. Essential for postembryonic development, especially during the formation of the shoot apical meristem (SAM).probableQ8GW31

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2A6T, chain A
Confidence level:very confident
Coverage over the Query: 1-175
View the alignment between query and template
View the model in PyMOL