Citrus Sinensis ID: 026092


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240---
MNGDSSRQMEVHYIDTGFAYTVTESFMDFFEGLTHAPVNYAQTGPIHDQENVYWSMNMHPYKFGFSGPESNYYYGSYEVNDHLPRIEASRRTWEYASTMNNVEPSTTDVQSEGEAVMGVHTAPEECSPHHQSSNSSQVVWQDNVDPDNMTYEELLDLGETVGTQSRGLSQEQINLLPTSKYKFGNLFLRKRSGERCVICQMKYKRGDRQMKLPCRHVYHSECITKWLGINKVTGLALKHNYIL
ccccccccCEEEEccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccHHHHHcccCEEECcccccccccccccccEEccccccccCEEEEcccccccHHHHHHHHcccccccccccccccc
******R***VHYIDTGFAYTVTESFMDFFEGLTHAPVNYAQTGPIHDQENVYWSMNMHPYKFGFSGPESNY**GSYEVNDHLPRIEASRRTWEY**************************************************PDNMTYEELLDLGETVGTQSRGLSQEQINLLPTSKYKFG*L*****SGERCVICQMKYKRGDRQMKLPCRHVYHSECITKWLGINKVTGLALKHNYIL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNGDSSRQMEVHYIDTGFAYTVTESFMDFFEGLTHAPVNYAQTGPIHDQENVYWSMNMHPYKFGFSGPESNYYYGSYEVNDHLPRIEASRRTWEYASTMNNVEPSTTDVQSEGEAVMGVHTAPEECSPHHQSSNSSQVVWQDNVDPDNMTYEELLDLGETVGTQSRGLSQEQINLLPTSKYKFGNLFLRKRSGERCVICQMKYKRGDRQMKLPCRHVYHSECITKWLGINKVTGLALKHNYIL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
E3 ubiquitin ligase BIG BROTHER E3 ubiquitin-ligase that limits organ size, and possibly seed size, in a dose-dependent manner. Negatively regulates the duration of cell proliferation in leaves and petals independently of the major phytohormones (e.g. auxin, cytokinin, gibberellin, brassinosteroids, ethylene, abscisic acid, jasmonic acid), probably by targeting growth stimulators for degradation.probableQ8L649

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2EP4, chain A
Confidence level:very confident
Coverage over the Query: 191-241
View the alignment between query and template
View the model in PyMOL
Template: 2L0B, chain A
Confidence level:confident
Coverage over the Query: 163-241
View the alignment between query and template
View the model in PyMOL