Citrus Sinensis ID: 026092

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240---
MNGDSSRQMEVHYIDTGFAYTVTESFMDFFEGLTHAPVNYAQTGPIHDQENVYWSMNMHPYKFGFSGPESNYYYGSYEVNDHLPRIEASRRTWEYASTMNNVEPSTTDVQSEGEAVMGVHTAPEECSPHHQSSNSSQVVWQDNVDPDNMTYEELLDLGETVGTQSRGLSQEQINLLPTSKYKFGNLFLRKRSGERCVICQMKYKRGDRQMKLPCRHVYHSECITKWLGINKVTGLALKHNYIL
ccccccccEEEEEccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccHHHHHcccEEEEEcccccccccccccccEEccccccccEEEEEcccccccHHHHHHHHcccccccccccccccc
cccccccccEEEEEcccccccccccHHHHHcccccccccHHHHccccccccccHHHccccccccccccccccccccccccccccccHHccccHHHccccccccHHHHHHHHHHcccccccccccccHHHccccccHHHHHHcccccccccHHHHHHHHHHcccccccccHHHHHHccccEEccccccccccccccEEEEEHEccccccEEEEcccccHHHHHHHHHHHHcccccccccEEEEc
mngdssrqmEVHYIDTGFAYTVTESFMDFFeglthapvnyaqtgpihdqenvywsmnmhpykfgfsgpesnyyygsyevndhlprieasRRTWEYAStmnnvepsttdvqsegeavmgvhtapeecsphhqssnssqvvwqdnvdpdnmtYEELLDLGetvgtqsrglsqeqinllptskykfgnlflrkrsgercvicqmkykrgdrqmklpcrhvyhsecITKWlginkvtglalkhnyil
MNGDSSRQMEVHYIDTGFAYTVTESFMDFFEGLTHAPVNYAQTGPIHDQENVYWSMNMHPYKFGFSGPESNYYYGSYEVNDHLPRIEASRRTWEYASTMNNVEPSTTDVQSEGEAVMGVHTAPEECSPHHQSSNSSQVVWQDNVDPDNMTYEELLDLGETVGTQSRGLSqeqinllptskykfgnlflrkrsgercVICQMkykrgdrqmklpCRHVYHSEcitkwlginkvtglalkhnyil
MNGDSSRQMEVHYIDTGFAYTVTESFMDFFEGLTHAPVNYAQTGPIHDQENVYWSMNMHPYKFGFSGPESNYYYGSYEVNDHLPRIEASRRTWEYASTMNNVEPSTTDVQSEGEAVMGVHTAPEECSPHHQSSNSSQVVWQDNVDPDNMTYEELLDLGETVGTQSRGLSQEQINLLPTSKYKFGNLFLRKRSGERCVICQMKYKRGDRQMKLPCRHVYHSECITKWLGINKVTGLALKHNYIL
**********VHYIDTGFAYTVTESFMDFFEGLTHAPVNYAQTGPIHDQENVYWSMNMHPYKFGFSGPESNYYYGSYEVNDHLPRIEASRRTWEY******************************************************TYEELLDLGETV**********QINLLPTSKYKFGNLFLRKRSGERCVICQMKYKRGDRQMKLPCRHVYHSECITKWLGINKVTGLALKHNYI*
******R***VHYIDTGFAYTVTESFMDFFEGLTHAPVNYAQTGPIHDQ************************************************************************************************PDNMTYEELLDLGETVGTQSRGLSQEQINLLPTSKYK*********SGERCVICQMKYKRGDRQMKLPCRHVYHSECITKWLGINKVTGLALKHNYIL
********MEVHYIDTGFAYTVTESFMDFFEGLTHAPVNYAQTGPIHDQENVYWSMNMHPYKFGFSGPESNYYYGSYEVNDHLPRIEASRRTWEYASTMNNVEPSTTDVQSEGEAVMGVHTA****************VWQDNVDPDNMTYEELLDLGETVGTQSRGLSQEQINLLPTSKYKFGNLFLRKRSGERCVICQMKYKRGDRQMKLPCRHVYHSECITKWLGINKVTGLALKHNYIL
******RQMEVHYIDTGFAYTVTESFMDFFEGLTHAPVNYAQTGPIHDQENVYWSMNMHPYKFGFSGPESNY**GSYEVNDHLPRIEASRRTWEYASTMNNVEPSTTDVQSEGEAVMGVHTAPEECSPHHQSSNSSQVVWQDNVDPDNMTYEELLDLGETVGTQSRGLSQEQINLLPTSKYKFG*L*****SGERCVICQMKYKRGDRQMKLPCRHVYHSECITKWLGINKVTGLALKHNYIL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNGDSSRQMEVHYIDTGFAYTVTESFMDFFEGLTHAPVNYAQTGPIHDQENVYWSMNMHPYKFGFSGPESNYYYGSYEVNDHLPRIEASRRTWEYASTMNNVEPSTTDVQSEGEAVMGVHTAPEECSPHHQSSNSSQVVWQDNVDPDNMTYEELLDLGETVGTQSRGLSQEQINLLPTSKYKFGNLFLRKRSGERCVICQMKYKRGDRQMKLPCRHVYHSECITKWLGINKVTGLALKHNYIL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query243 2.2.26 [Sep-21-2011]
Q8L649248 E3 ubiquitin ligase BIG B yes no 0.954 0.935 0.545 8e-74
Q9LT17340 E3 ubiquitin ligase BIG B no no 0.399 0.285 0.51 4e-23
Q08CG8448 RING finger protein 44 OS yes no 0.370 0.200 0.312 4e-08
Q9H0F5515 RING finger protein 38 OS yes no 0.337 0.159 0.313 5e-08
Q8BI21518 RING finger protein 38 OS yes no 0.337 0.158 0.313 1e-07
Q7T037757 E3 ubiquitin-protein liga N/A no 0.312 0.100 0.341 1e-07
Q4V7B8350 RING finger protein 44 OS no no 0.370 0.257 0.333 3e-07
Q07G42639 E3 ubiquitin-protein liga no no 0.320 0.122 0.321 3e-07
Q7L0R7432 RING finger protein 44 OS no no 0.366 0.206 0.336 3e-07
Q3UHJ8407 RING finger protein 44 OS no no 0.370 0.221 0.333 3e-07
>sp|Q8L649|BB_ARATH E3 ubiquitin ligase BIG BROTHER OS=Arabidopsis thaliana GN=BB PE=1 SV=1 Back     alignment and function desciption
 Score =  276 bits (707), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 127/233 (54%), Positives = 163/233 (69%), Gaps = 1/233 (0%)

Query: 1   MNGDSSRQMEVHYIDTGFAYTVTESFMDFFEGLTHAPVNYAQTGPIHDQENVYWSMNMHP 60
           MNGD+    + HY +TGF Y  T S+MDF+ G    P+NY     +H Q+N+YW+MN + 
Sbjct: 1   MNGDNRPVEDAHYTETGFPYAATGSYMDFYGGAAQGPLNYDHAATMHPQDNLYWTMNTNA 60

Query: 61  YKFGFSGPESNYYYGSYEVNDHLPRIEASRRTWEYASTMNNVE-PSTTDVQSEGEAVMGV 119
           YKFGFSG ++  +YGSY++NDHL R+   R  W+Y   +N  + P  T  +S        
Sbjct: 61  YKFGFSGSDNASFYGSYDMNDHLSRMSIGRTNWDYHPMVNVADDPENTVARSVQIGDTDE 120

Query: 120 HTAPEECSPHHQSSNSSQVVWQDNVDPDNMTYEELLDLGETVGTQSRGLSQEQINLLPTS 179
           H+  EEC  +    +S QV WQD++DPD MTYEEL++LGE VGT+SRGLSQE I  LPT 
Sbjct: 121 HSEAEECIANEHDPDSPQVSWQDDIDPDTMTYEELVELGEAVGTESRGLSQELIETLPTK 180

Query: 180 KYKFGNLFLRKRSGERCVICQMKYKRGDRQMKLPCRHVYHSECITKWLGINKV 232
           KYKFG++F RKR+GERCVICQ+KYK G+RQM LPC+HVYHSECI+KWL INKV
Sbjct: 181 KYKFGSIFSRKRAGERCVICQLKYKIGERQMNLPCKHVYHSECISKWLSINKV 233
E3 ubiquitin-ligase that limits organ size, and possibly seed size, in a dose-dependent manner. Negatively regulates the duration of cell proliferation in leaves and petals independently of the major phytohormones (e.g. auxin, cytokinin, gibberellin, brassinosteroids, ethylene, abscisic acid, jasmonic acid), probably by targeting growth stimulators for degradation.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q9LT17|BBR_ARATH E3 ubiquitin ligase BIG BROTHER-related OS=Arabidopsis thaliana GN=BBR PE=2 SV=1 Back     alignment and function description
>sp|Q08CG8|RNF44_DANRE RING finger protein 44 OS=Danio rerio GN=rnf44 PE=2 SV=1 Back     alignment and function description
>sp|Q9H0F5|RNF38_HUMAN RING finger protein 38 OS=Homo sapiens GN=RNF38 PE=1 SV=4 Back     alignment and function description
>sp|Q8BI21|RNF38_MOUSE RING finger protein 38 OS=Mus musculus GN=Rnf38 PE=2 SV=1 Back     alignment and function description
>sp|Q7T037|RF12B_XENLA E3 ubiquitin-protein ligase RNF12-B OS=Xenopus laevis GN=rnf12-b PE=2 SV=1 Back     alignment and function description
>sp|Q4V7B8|RNF44_RAT RING finger protein 44 OS=Rattus norvegicus GN=Rnf44 PE=2 SV=1 Back     alignment and function description
>sp|Q07G42|RNF12_XENTR E3 ubiquitin-protein ligase RNF12 OS=Xenopus tropicalis GN=rnf12 PE=2 SV=1 Back     alignment and function description
>sp|Q7L0R7|RNF44_HUMAN RING finger protein 44 OS=Homo sapiens GN=RNF44 PE=2 SV=1 Back     alignment and function description
>sp|Q3UHJ8|RNF44_MOUSE RING finger protein 44 OS=Mus musculus GN=Rnf44 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query243
255582236240 protein binding protein, putative [Ricin 0.917 0.929 0.743 6e-96
359487286247 PREDICTED: E3 ubiquitin ligase BIG BROTH 0.942 0.927 0.714 4e-94
356544176247 PREDICTED: E3 ubiquitin ligase BIG BROTH 0.938 0.923 0.695 2e-91
356548935247 PREDICTED: E3 ubiquitin ligase BIG BROTH 0.938 0.923 0.686 2e-90
255645317247 unknown [Glycine max] 0.938 0.923 0.678 5e-89
357514813288 E3 ubiquitin-protein ligase Arkadia [Med 0.938 0.791 0.659 3e-85
255642062207 unknown [Glycine max] 0.827 0.971 0.679 7e-77
224059640203 predicted protein [Populus trichocarpa] 0.773 0.926 0.629 2e-76
297821276247 hypothetical protein ARALYDRAFT_324777 [ 0.950 0.935 0.553 4e-72
22331928248 E3 ubiquitin ligase BIG BROTHER [Arabido 0.954 0.935 0.545 5e-72
>gi|255582236|ref|XP_002531910.1| protein binding protein, putative [Ricinus communis] gi|223528450|gb|EEF30483.1| protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  356 bits (913), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 168/226 (74%), Positives = 194/226 (85%), Gaps = 3/226 (1%)

Query: 9   MEVHYIDTGFAYTVTESFMDFFEGLTHAPVNYAQTGPIHDQ--ENVYWSMNMHPYKFGFS 66
           MEVHYI+TGF YTVTESF+DFFEGL+H PV+YA TG + DQ  EN YWSMNM+ YK+GFS
Sbjct: 1   MEVHYINTGFPYTVTESFLDFFEGLSHVPVHYAHTGQVLDQVQENAYWSMNMNAYKYGFS 60

Query: 67  GPESNYYYGSYEVNDHLPRIEASRRTWEYASTMNNVEPSTTDVQSEGEAVMGVHTAPEEC 126
           GP S YY   YEVND+LPR++ SR TWEY S +N  E +TTD QSEG+AV+GVH +PEEC
Sbjct: 61  GPGSTYY-DPYEVNDNLPRMDVSRSTWEYPSVVNMEEATTTDTQSEGDAVVGVHASPEEC 119

Query: 127 SPHHQSSNSSQVVWQDNVDPDNMTYEELLDLGETVGTQSRGLSQEQINLLPTSKYKFGNL 186
            P+H S +S Q VWQD+VDPDNMTYEELLDLGETVGTQSRGLSQE I+LLPTSK KF + 
Sbjct: 120 IPNHTSGDSPQGVWQDDVDPDNMTYEELLDLGETVGTQSRGLSQELISLLPTSKCKFRSF 179

Query: 187 FLRKRSGERCVICQMKYKRGDRQMKLPCRHVYHSECITKWLGINKV 232
           FLRK++GERCVICQM+YKRGD+QMKLPC+HVYHSECI+KWLGINKV
Sbjct: 180 FLRKKAGERCVICQMRYKRGDKQMKLPCKHVYHSECISKWLGINKV 225

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359487286|ref|XP_002279794.2| PREDICTED: E3 ubiquitin ligase BIG BROTHER [Vitis vinifera] gi|297736239|emb|CBI24877.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356544176|ref|XP_003540530.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Glycine max] Back     alignment and taxonomy information
>gi|356548935|ref|XP_003542854.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-like [Glycine max] Back     alignment and taxonomy information
>gi|255645317|gb|ACU23155.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|357514813|ref|XP_003627695.1| E3 ubiquitin-protein ligase Arkadia [Medicago truncatula] gi|355521717|gb|AET02171.1| E3 ubiquitin-protein ligase Arkadia [Medicago truncatula] Back     alignment and taxonomy information
>gi|255642062|gb|ACU21297.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|224059640|ref|XP_002299947.1| predicted protein [Populus trichocarpa] gi|222847205|gb|EEE84752.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297821276|ref|XP_002878521.1| hypothetical protein ARALYDRAFT_324777 [Arabidopsis lyrata subsp. lyrata] gi|297324359|gb|EFH54780.1| hypothetical protein ARALYDRAFT_324777 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|22331928|ref|NP_680148.1| E3 ubiquitin ligase BIG BROTHER [Arabidopsis thaliana] gi|79316205|ref|NP_001030922.1| E3 ubiquitin ligase BIG BROTHER [Arabidopsis thaliana] gi|75301060|sp|Q8L649.1|BB_ARATH RecName: Full=E3 ubiquitin ligase BIG BROTHER; AltName: Full=Protein ENHANCER OF DA1-1 gi|21104275|emb|CAD32249.1| putative protein [Arabidopsis thaliana] gi|33589800|gb|AAQ22666.1| At3g63530 [Arabidopsis thaliana] gi|110743646|dbj|BAE99660.1| hypothetical protein [Arabidopsis thaliana] gi|332646978|gb|AEE80499.1| E3 ubiquitin ligase BIG BROTHER [Arabidopsis thaliana] gi|332646979|gb|AEE80500.1| E3 ubiquitin ligase BIG BROTHER [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query243
TAIR|locus:504955576248 BB "BIG BROTHER" [Arabidopsis 0.954 0.935 0.545 7.7e-71
TAIR|locus:2092271340 AT3G19910 [Arabidopsis thalian 0.539 0.385 0.420 6.4e-26
TAIR|locus:2145086280 AT5G52140 [Arabidopsis thalian 0.427 0.371 0.455 1e-20
TAIR|locus:2075641210 AT3G47180 [Arabidopsis thalian 0.366 0.423 0.436 1.2e-17
TAIR|locus:2159634525 AT5G10650 [Arabidopsis thalian 0.345 0.16 0.426 5.2e-13
TAIR|locus:2028225645 AT1G45180 [Arabidopsis thalian 0.337 0.127 0.435 2.3e-11
TAIR|locus:2149378520 AT5G24870 [Arabidopsis thalian 0.345 0.161 0.426 1.5e-10
TAIR|locus:2125284497 AT4G31450 [Arabidopsis thalian 0.353 0.173 0.4 2.6e-10
TAIR|locus:2160031691 AT5G42940 [Arabidopsis thalian 0.337 0.118 0.411 3.3e-10
TAIR|locus:2086305486 AT3G15070 [Arabidopsis thalian 0.378 0.189 0.402 6.5e-10
TAIR|locus:504955576 BB "BIG BROTHER" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 717 (257.5 bits), Expect = 7.7e-71, P = 7.7e-71
 Identities = 127/233 (54%), Positives = 163/233 (69%)

Query:     1 MNGDSSRQMEVHYIDTGFAYTVTESFMDFFEGLTHAPVNYAQTGPIHDQENVYWSMNMHP 60
             MNGD+    + HY +TGF Y  T S+MDF+ G    P+NY     +H Q+N+YW+MN + 
Sbjct:     1 MNGDNRPVEDAHYTETGFPYAATGSYMDFYGGAAQGPLNYDHAATMHPQDNLYWTMNTNA 60

Query:    61 YKFGFSGPESNYYYGSYEVNDHLPRIEASRRTWEYASTMNNVE-PSTTDVQSEGEAVMGV 119
             YKFGFSG ++  +YGSY++NDHL R+   R  W+Y   +N  + P  T  +S        
Sbjct:    61 YKFGFSGSDNASFYGSYDMNDHLSRMSIGRTNWDYHPMVNVADDPENTVARSVQIGDTDE 120

Query:   120 HTAPEECSPHHQSSNSSQVVWQDNVDPDNMTYEELLDLGETVGTQSRGLSQEQINLLPTS 179
             H+  EEC  +    +S QV WQD++DPD MTYEEL++LGE VGT+SRGLSQE I  LPT 
Sbjct:   121 HSEAEECIANEHDPDSPQVSWQDDIDPDTMTYEELVELGEAVGTESRGLSQELIETLPTK 180

Query:   180 KYKFGNLFLRKRSGERCVICQMKYKRGDRQMKLPCRHVYHSECITKWLGINKV 232
             KYKFG++F RKR+GERCVICQ+KYK G+RQM LPC+HVYHSECI+KWL INKV
Sbjct:   181 KYKFGSIFSRKRAGERCVICQLKYKIGERQMNLPCKHVYHSECISKWLSINKV 233
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0004842 "ubiquitin-protein ligase activity" evidence=IDA
GO:0016567 "protein ubiquitination" evidence=IDA
GO:0031624 "ubiquitin conjugating enzyme binding" evidence=IPI
GO:0046621 "negative regulation of organ growth" evidence=IMP
GO:0048437 "floral organ development" evidence=IMP
GO:0051865 "protein autoubiquitination" evidence=IDA
TAIR|locus:2092271 AT3G19910 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2145086 AT5G52140 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075641 AT3G47180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2159634 AT5G10650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2028225 AT1G45180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149378 AT5G24870 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2125284 AT4G31450 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2160031 AT5G42940 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086305 AT3G15070 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8L649BB_ARATH6, ., 3, ., 2, ., -0.54500.95470.9354yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00028813001
SubName- Full=Chromosome chr13 scaffold_45, whole genome shotgun sequence; (244 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query243
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 2e-10
cd0016245 cd00162, RING, RING-finger (Really Interesting New 5e-07
COG5540374 COG5540, COG5540, RING-finger-containing ubiquitin 1e-06
smart0018440 smart00184, RING, Ring finger 2e-05
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 2e-05
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 9e-05
pfam1267873 pfam12678, zf-rbx1, RING-H2 zinc finger 9e-04
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information 
 Score = 54.3 bits (131), Expect = 2e-10
 Identities = 15/36 (41%), Positives = 23/36 (63%)

Query: 196 CVICQMKYKRGDRQMKLPCRHVYHSECITKWLGINK 231
           C IC  +++ G+  + LPC HV+H EC+ KWL  + 
Sbjct: 3   CPICLDEFEPGEEVVVLPCGHVFHKECLDKWLRSSN 38

Length = 46
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|221705 pfam12678, zf-rbx1, RING-H2 zinc finger Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 243
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 99.66
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.59
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 99.43
PHA02929238 N1R/p28-like protein; Provisional 99.37
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 99.32
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 99.18
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 99.09
cd0016245 RING RING-finger (Really Interesting New Gene) dom 99.08
PLN03208 193 E3 ubiquitin-protein ligase RMA2; Provisional 99.0
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 99.0
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 98.99
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 98.95
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 98.93
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 98.91
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.89
PHA02926242 zinc finger-like protein; Provisional 98.87
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.86
PF1463444 zf-RING_5: zinc-RING finger domain 98.86
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.82
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.82
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.82
KOG149384 consensus Anaphase-promoting complex (APC), subuni 98.78
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.75
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 98.68
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.63
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 98.51
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 98.47
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 98.42
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.41
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.37
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 98.34
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.31
COG52191525 Uncharacterized conserved protein, contains RING Z 98.31
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.23
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 98.23
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 98.12
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.03
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 98.0
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 97.98
KOG1039 344 consensus Predicted E3 ubiquitin ligase [Posttrans 97.85
KOG0825 1134 consensus PHD Zn-finger protein [General function 97.75
KOG4445 368 consensus Uncharacterized conserved protein, conta 97.68
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 97.65
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 97.62
KOG1941518 consensus Acetylcholine receptor-associated protei 97.38
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 97.28
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 97.09
KOG0297 391 consensus TNF receptor-associated factor [Signal t 97.06
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 96.91
KOG1785 563 consensus Tyrosine kinase negative regulator CBL [ 96.87
KOG1428 3738 consensus Inhibitor of type V adenylyl cyclases/Ne 96.8
KOG3970 299 consensus Predicted E3 ubiquitin ligase [Posttrans 96.78
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 96.78
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 96.73
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 96.7
KOG0801205 consensus Predicted E3 ubiquitin ligase [Posttrans 96.46
KOG3268234 consensus Predicted E3 ubiquitin ligase [Posttrans 96.43
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 96.42
PHA02862 156 5L protein; Provisional 96.27
KOG2660 331 consensus Locus-specific chromosome binding protei 96.26
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 96.24
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 96.22
PHA02825 162 LAP/PHD finger-like protein; Provisional 96.19
COG5152259 Uncharacterized conserved protein, contains RING a 96.17
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 96.16
PHA03096284 p28-like protein; Provisional 96.15
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 96.13
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 96.01
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 95.77
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 95.68
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 95.63
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 95.62
KOG1002 791 consensus Nucleotide excision repair protein RAD16 95.49
COG5222 427 Uncharacterized conserved protein, contains RING Z 95.18
KOG3039303 consensus Uncharacterized conserved protein [Funct 95.17
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 94.8
COG5236 493 Uncharacterized conserved protein, contains RING Z 94.51
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 94.44
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 94.2
PF04641260 Rtf2: Rtf2 RING-finger 94.0
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 93.86
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 93.11
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 92.88
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 92.84
KOG1001 674 consensus Helicase-like transcription factor HLTF/ 92.52
KOG1940276 consensus Zn-finger protein [General function pred 92.43
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 91.7
COG5175 480 MOT2 Transcriptional repressor [Transcription] 91.54
PF10272358 Tmpp129: Putative transmembrane protein precursor; 91.3
KOG3053 293 consensus Uncharacterized conserved protein [Funct 90.73
KOG1609 323 consensus Protein involved in mRNA turnover and st 90.58
KOG3002 299 consensus Zn finger protein [General function pred 89.33
KOG03091081 consensus Conserved WD40 repeat-containing protein 88.8
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 88.07
KOG0298 1394 consensus DEAD box-containing helicase-like transc 87.88
KOG3899381 consensus Uncharacterized conserved protein [Funct 87.53
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 86.52
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 83.63
KOG1812 384 consensus Predicted E3 ubiquitin ligase [Posttrans 82.97
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 82.88
COG5183 1175 SSM4 Protein involved in mRNA turnover and stabili 80.79
KOG0825 1134 consensus PHD Zn-finger protein [General function 80.69
KOG3005276 consensus GIY-YIG type nuclease [General function 80.01
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.66  E-value=4.1e-17  Score=150.94  Aligned_cols=73  Identities=26%  Similarity=0.612  Sum_probs=62.7

Q ss_pred             CCCCCHHHHhhCCceeeecCchhhccCCCcccccccccccCCCeeEEeCCCCcccHHHHHHHHhcCC-CCCccCccc
Q 026092          165 SRGLSQEQINLLPTSKYKFGNLFLRKRSGERCVICQMKYKRGDRQMKLPCRHVYHSECITKWLGINK-VTGLALKHN  240 (243)
Q Consensus       165 ~rGLs~~~I~sLp~~~~k~~~~~~~~~~~~~C~ICle~f~~ge~v~~LPC~H~FH~~CI~~WLk~~~-tCPlCR~~v  240 (243)
                      .+.+.+..+.++|..+|+.....   .....|+||+++|+.|++++.|||+|.||..||++||..++ .||+||+.+
T Consensus       204 ~~r~~k~~l~~~p~~~f~~~~~~---~~~~~CaIClEdY~~GdklRiLPC~H~FH~~CIDpWL~~~r~~CPvCK~di  277 (348)
T KOG4628|consen  204 RNRLIKRLLKKLPVRTFTKGDDE---DATDTCAICLEDYEKGDKLRILPCSHKFHVNCIDPWLTQTRTFCPVCKRDI  277 (348)
T ss_pred             hhhhHHHHHhhCCcEEecccccc---CCCceEEEeecccccCCeeeEecCCCchhhccchhhHhhcCccCCCCCCcC
Confidence            34789999999999999875321   11269999999999999999999999999999999998774 599999876

>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0801 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>KOG3053 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1609 consensus Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>KOG3899 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG3005 consensus GIY-YIG type nuclease [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query243
2ep4_A74 Solution Structure Of Ring Finger From Human Ring F 2e-04
2ect_A78 Solution Structure Of The Zinc Finger, C3hc4 Type ( 3e-04
2kiz_A69 Solution Structure Of Arkadia Ring-H2 Finger Domain 6e-04
>pdb|2EP4|A Chain A, Solution Structure Of Ring Finger From Human Ring Finger Protein 24 Length = 74 Back     alignment and structure 
Iteration: 1

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 23/42 (54%)
Query: 194 ERCVICQMKYKRGDRQMKLPCRHVYHSECITKWLGINKVTGL 235
           E C +C   +K  D     PC+H +H +C+ KWL + KV  L
Sbjct: 16  ELCAVCLEDFKPRDELGICPCKHAFHRKCLIKWLEVRKVCPL 57
>pdb|2ECT|A Chain A, Solution Structure Of The Zinc Finger, C3hc4 Type (Ring Finger) Domain Of Ring Finger Protein 126 Length = 78 Back     alignment and structure
>pdb|2KIZ|A Chain A, Solution Structure Of Arkadia Ring-H2 Finger Domain Length = 69 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query243
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 7e-16
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 2e-15
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 1e-13
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 2e-11
2ect_A78 Ring finger protein 126; metal binding protein, st 2e-11
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 7e-09
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 7e-09
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 9e-08
2ecm_A55 Ring finger and CHY zinc finger domain- containing 7e-07
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 7e-07
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 2e-06
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 7e-06
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 1e-05
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 5e-05
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 7e-05
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 3e-04
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 4e-04
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 6e-04
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 6e-04
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 9e-04
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
 Score = 69.3 bits (170), Expect = 7e-16
 Identities = 17/64 (26%), Positives = 29/64 (45%), Gaps = 3/64 (4%)

Query: 169 SQEQINLLPTSKYKFGNLFLRKRSGERCVICQMKYKRGDRQMKLPCRHVYHSECITKWLG 228
           S      LP+ ++   N    +     CV+C   ++       LPC H +H++C+ KWL 
Sbjct: 2   SSGSSGQLPSYRFNPNN---HQSEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLK 58

Query: 229 INKV 232
            N+ 
Sbjct: 59  ANRT 62
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query243
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.74
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.68
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.63
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.57
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.57
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.56
2ect_A78 Ring finger protein 126; metal binding protein, st 99.54
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 99.53
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.51
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.46
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.46
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.45
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 99.45
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.42
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.39
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.39
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.38
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.36
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.35
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.34
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.33
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.33
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.32
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.3
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.29
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.26
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.25
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.24
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.24
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.23
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.22
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.22
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.22
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 99.21
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.2
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.19
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.18
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.17
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.17
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.17
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.16
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.13
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.1
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.09
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.07
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 99.06
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.04
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 99.03
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 99.02
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.0
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.99
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 98.98
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.96
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.94
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.91
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.9
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.89
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.86
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 98.84
3hcs_A 170 TNF receptor-associated factor 6; cross-brace, bet 98.82
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.79
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 98.77
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.7
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.66
2ea5_A68 Cell growth regulator with ring finger domain prot 98.65
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.61
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.52
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.51
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.45
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.36
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 98.26
3nw0_A238 Non-structural maintenance of chromosomes element 97.88
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 94.04
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 93.24
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 92.79
1wil_A89 KIAA1045 protein; ring finger domain, structural g 90.28
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 88.3
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 86.02
1we9_A64 PHD finger family protein; structural genomics, PH 83.27
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 83.15
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 82.68
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 82.6
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
Probab=99.74  E-value=2.7e-18  Score=129.29  Aligned_cols=77  Identities=25%  Similarity=0.425  Sum_probs=66.7

Q ss_pred             CCCCCCCHHHHhhCCceeeecCchhhccCCCcccccccccccCCCeeEEeCCCCcccHHHHHHHHhcCCCCCccCcccc
Q 026092          163 TQSRGLSQEQINLLPTSKYKFGNLFLRKRSGERCVICQMKYKRGDRQMKLPCRHVYHSECITKWLGINKVTGLALKHNY  241 (243)
Q Consensus       163 ~~~rGLs~~~I~sLp~~~~k~~~~~~~~~~~~~C~ICle~f~~ge~v~~LPC~H~FH~~CI~~WLk~~~tCPlCR~~v~  241 (243)
                      ...+|++++.|++||..++....  ........|+||++.|..++.++.|||+|.||..||.+||+.+.+||+||+++.
T Consensus        12 ~~~~~~s~~~i~~lp~~~~~~~~--~~~~~~~~C~IC~~~~~~~~~~~~l~C~H~Fh~~Ci~~wl~~~~~CP~Cr~~~~   88 (91)
T 2l0b_A           12 VANPPASKESIDALPEILVTEDH--GAVGQEMCCPICCSEYVKGDVATELPCHHYFHKPCVSIWLQKSGTCPVCRCMFP   88 (91)
T ss_dssp             SCCCCCCHHHHHTSCEEECCTTC--SSSSSCSEETTTTEECCTTCEEEEETTTEEEEHHHHHHHHTTTCBCTTTCCBSS
T ss_pred             cCCCCCCHHHHHhCCCeeecccc--cccCCCCCCcccChhhcCCCcEEecCCCChHHHHHHHHHHHcCCcCcCcCccCC
Confidence            34679999999999998876542  223456789999999999999999999999999999999999999999999874
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 243
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 3e-10
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 1e-08
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 5e-06
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 1e-05
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 2e-05
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 4e-05
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 1e-04
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 3e-04
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 0.001
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 0.002
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]

 Score = 52.2 bits (125), Expect = 3e-10
 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 1/40 (2%)

Query: 193 GERCVICQMKYKRGDRQMKLP-CRHVYHSECITKWLGINK 231
           G  C +C  + + G+    LP C H +H+EC+  WLG + 
Sbjct: 5   GVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHS 44
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query243
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.73
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.55
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.53
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.47
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.43
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.42
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.41
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.29
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.2
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.19
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.17
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 99.07
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.99
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.99
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.96
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.78
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.51
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 91.68
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 85.2
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 84.95
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 84.61
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 82.82
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]

Probab=99.73  E-value=7.1e-19  Score=120.15  Aligned_cols=52  Identities=29%  Similarity=0.715  Sum_probs=47.9

Q ss_pred             CCCcccccccccccCCCeeEEeC-CCCcccHHHHHHHHhcCCCCCccCccccc
Q 026092          191 RSGERCVICQMKYKRGDRQMKLP-CRHVYHSECITKWLGINKVTGLALKHNYI  242 (243)
Q Consensus       191 ~~~~~C~ICle~f~~ge~v~~LP-C~H~FH~~CI~~WLk~~~tCPlCR~~v~i  242 (243)
                      ++..+|+||+++|..++.++++| |+|.||..||.+||+.+++||+||++|+|
T Consensus         3 ed~~~C~ICl~~~~~~~~~~~l~~C~H~Fh~~Ci~~Wl~~~~~CP~CR~~i~v   55 (55)
T d1iyma_           3 DDGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTVVV   55 (55)
T ss_dssp             CCSCCCTTTCCCCCTTSCCEECSSSCCEECTTHHHHTTTTCCSCSSSCCCSCC
T ss_pred             CCCCCCeEECccccCCCEEEEeCCCCCcccHHHHHHHHHhCCcCCCCCCEeEC
Confidence            34578999999999999998886 99999999999999999999999999975
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure