Citrus Sinensis ID: 026103

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240---

MDILFGQVSDPGLTDNKPESSTQSDASSTAPPRRGAHSDEEVVLLATSRPKKRAGRRVFKETRHPIFRGVRMRNNNKWVCELREPNKQTRIWLGTYPSPEMAARAHDVAALALRGKSACLNFADSVWRLPVPASTDAKDIRKAAAEAAEAFRPRDDELEESNIHHVKLEEVQKTMQENTLLPENVLYMDEHAVFDMPGLLADMAEGLLLSPPPLLFGDDDVMKWDYHNNGESDGCVSLWSHSI

cccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccEEEEcccccEEEEEEcccccccEEccccccHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccc

*********************************************************VFKETRHPIFRGVRMRNNNKWVCELREPNKQTRIWLGTYPSPEMAARAHDVAALALRGKSACLNFADSVWRLPVP*******IRKAAAEA*************************************VLYMDEHAVFDMPGLLADMAEGLLLSPPPLLFGDDDVMKWDYHNNGESDGCVSLWSHSI

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Dehydration-responsive element-binding protein 1C	Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]CCGAC-3'. Binding to the C-repeat/DRE element mediates cold-inducible transcription. CBF/DREB1 factors play a key role in freezing tolerance and cold acclimation.	probable	Q9SYS6
Dehydration-responsive element-binding protein 1F	Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]CCGAC-3'. Binding to the C-repeat/DRE element mediates high salinity- and dehydration-inducible transcription.	probable	Q8S9Z5

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1GCC, chain A
Confidence level:confident
Coverage over the Query: 66-125
View the alignment between query and template
View the model in PyMOL