Citrus Sinensis ID: 026104


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240---
MASRLQQIEGDESVLLRVTHSNLKSFSADVRFPLQMSVESVKDKLWRKCGTSVNSMSLELYDDTNTKVAALTDNSRPLGFYSPLQGYRLHVIDLDPSSVTSGGWLEDTSLVEKYTISEEEYSKRDGTFRKFKEKVLSQNPSAVENKLSNNYMEDLCSNITVGDRCEVDPGAKRGVVKYVGQAESIAPGFWVGIQYDEPLGKHNGIVKGVRYFECPPLHGAMVRPDKVKVGDYPERDPFEEDEI
cccccccccccccEEEEEEccccccccCEEEccccccHHHHHHccccECccccccEEEEEEcccccEEEEcccccccccccccccccEEEEEcccccccccccccccccccccccccHHHHHcccccHHHHHHHHHcccccHHHHcccccHHHHcccccccccEEEEcccccEEEEEEEECcccccccCEEEEEEcccccccccEEccEEEECcccccEEEEccccEEEcccccccccccccc
*********GDESVLLRVTHSNLKSFSADVRFPLQMSVESVKDKLWRKCGTSVNSMSLELYDDTNTKVAALTDNSRPLGFYSPLQGYRLHVIDLDPSSVTSGGWLEDTSLVEKYTI********************************NNYMEDLCSNITVGDRCEVDPGAKRGVVKYVGQAESIAPGFWVGIQYDEPLGKHNGIVKGVRYFECPPLHGAMVRPDKVKVGDYPERD****DEI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASRLQQIEGDESVLLRVTHSNLKSFSADVRFPLQMSVESVKDKLWRKCGTSVNSMSLELYDDTNTKVAALTDNSRPLGFYSPLQGYRLHVIDLDPSSVTSGGWLEDTSLVEKYTISEEEYSKRDGTFRKFKEKVLSQNPSAVENKLSNNYMEDLCSNITVGDRCEVDPGAKRGVVKYVGQAESIAPGFWVGIQYDEPLGKHNGIVKGVRYFECPPLHGAMVRPDKVKVGDYPERDPFEEDEI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Tubulin-folding cofactor B Binds to alpha-tubulin folding intermediates after their interaction with cytosolic chaperonin in the pathway leading from newly synthesized tubulin to properly folded heterodimer (By similarity). Involved in regulation of tubulin heterodimer dissociation. May function as a negative regulator of axonal growth.probableQ9D1E6
Tubulin-folding cofactor B Binds to alpha-tubulin folding intermediates after their interaction with cytosolic chaperonin in the pathway leading from newly synthesized tubulin to properly folded heterodimer. Involved in regulation of tubulin heterodimer dissociation. May function as a negative regulator of axonal growth.probableQ99426
Tubulin-folding cofactor B Binds to alpha-tubulin folding intermediates after their interaction with cytosolic chaperonin in the pathway leading from newly synthesized tubulin to properly folded heterodimer. Involved in regulation of tubulin heterodimer dissociation. May function as a negative regulator of axonal growth.probableQ5E951

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1T0Y, chain A
Confidence level:very confident
Coverage over the Query: 11-104
View the alignment between query and template
View the model in PyMOL
Template: 1WHG, chain A
Confidence level:very confident
Coverage over the Query: 153-236
View the alignment between query and template
View the model in PyMOL