Citrus Sinensis ID: 026107


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240---
MMSTGELLNIEPQELQFPFELRKQISCSLQLSNKTDNYVAFKVKTTNPKKYCVRPNTGVVLPRSTCDVIVTMQSQKEAPPDMQCKDKFLLQGVVASPGATAKDITPEMFNKEAGHHVEECKLRVLYVAPPRPPSPVHEGSEEGSSPRASVSDNGNFSASEFSAAASRAFVEQYEPQDKSTEARALISKLTEEKNSVIQINNKLQQELELLRRQANRSSSGLPFIYVVIVGFIGIILGYLMKKI
cccccccEEEccccCECccccccEEEEEEEEECccccEEEEEEECcccccEEECcccCEEccccCEEEEEEEccccccccccccccCEEEEEEEcccccccccccccccccccccCEEEEEEEEEEccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHccc
****GEL**IEPQELQFPFELRKQISCSLQLSNKTDNYVAFKVKTTNPKKYCVRPNTGVVLPRSTCDVIVTMQSQKEAPPDMQCKDKFLLQGVVASPGATAKDITPEMFNKEAGHHVEECKLRVLYV********************************************************************************************GLPFIYVVIVGFIGIILGYLMKKI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMSTGELLNIEPQELQFPFELRKQISCSLQLSNKTDNYVAFKVKTTNPKKYCVRPNTGVVLPRSTCDVIVTMQSQKEAPPDMQCKDKFLLQGVVASPGATAKDITPEMFNKEAGHHVEECKLRVLYVAPPRPPSPVHEGSEEGSSPRASVSDNGNFSASEFSAAASRAFVEQYEPQDKSTEARALxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLPFIYVVIVGFIGIILGYLMKKI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Vesicle-associated protein 1-2 Vesicle-associated protein that binds the oxysterol-binding protein ORP3A and allows its targeting to the ER.confidentQ9SHC8
Vesicle-associated protein 1-1 May play a role in vesicle trafficking.probableQ8VZ95

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WIC, chain A
Confidence level:very confident
Coverage over the Query: 4-143
View the alignment between query and template
View the model in PyMOL
Template: 1NLW, chain A
Confidence level:probable
Coverage over the Query: 178-214
View the alignment between query and template
View the model in PyMOL