Citrus Sinensis ID: 026113


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240---
MSMASQVIREWMGIQQFPPATQTKLLELLGKLKQENVNTLTILVMGKGGVGKSSTVNSIIGEKAVTVSTFQSEGPRPVMVSRSRAGFTLNIVDTPGLIEGGYVNYHAIQLIKRFLLNKTIDVLLYVDRLDVYRVDNLDKQITRAITDNFGEQIWKRALIVLTHAQLSLPDRLDYEVFCSKRSEALLKFVSPSTWMKKKDIQGSFVPVVLVENSGRCAKNENDEKVSQLPDNRIQCCFPRNVFY
ccHHHHHHHHccccccccHHHHHHHHHHHHHHcccccccEEEEEEcccccccHHHHHHHHcccccccccccccccCEEEEEEEEccEEEEEEEcccccccccccHHHHHHHHHHHccccccEEEEEEECccccccHHHHHHHHHHHHHHcHHHHccEEEEEEcccccccccccHHHHHHHccHHHHHHHcccccccHHccccccccEEEEEcccccccccccccccccccccccccccccccc
******VIREWMGIQQFPPATQTKLLELLGKLKQENVNTLTILVMGKGGVGKSSTVNSIIGEKAVTVSTF*******VMVSRSRAGFTLNIVDTPGLIEGGYVNYHAIQLIKRFLLNKTIDVLLYVDRLDVYRVDNLDKQITRAITDNFGEQIWKRALIVLTHAQLSLPDRLDYEVFCSKRSEALLKFVSPSTWMKKKDIQGSFVPVVLVENSGRCAKNENDEKVSQLPDNRIQCCFPRNVFY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSMASQVIREWMGIQQFPPATQTKLLELLGKLKQENVNTLTILVMGKGGVGKSSTVNSIIGEKAVTVSTFQSEGPRPVMVSRSRAGFTLNIVDTPGLIEGGYVNYHAIQLIKRFLLNKTIDVLLYVDRLDVYRVDNLDKQITRAITDNFGEQIWKRALIVLTHAQLSLPDRLDYEVFCSKRSEALLKFVSPSTWMKKKDIQGSFVPVVLVENSGRCAKNENDEKVSQLPDNRIQCCFPRNVFY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Translocase of chloroplast 34, chloroplastic GTPase involved in protein precursor import into chloroplasts. Seems to recognize chloroplast-destined precursor proteins and regulate their presentation to the translocation channel through GTP hydrolysis. Probably specialized in the import of nuclear encoded non-photosynthetic preproteins from the cytoplasm to the chloroplast.probableQ38906
Translocase of chloroplast 34 GTPase involved in protein precursor import into chloroplasts. Seems to recognize chloroplast-destined precursor proteins and regulate their presentation to the translocation channel through GTP hydrolysis.probableQ41009

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DEF, chain A
Confidence level:very confident
Coverage over the Query: 9-239
View the alignment between query and template
View the model in PyMOL