Citrus Sinensis ID: 026122

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240---
MPFFNGTGYPFSVFMFMFFYLGLFLKKRKQNLQKMNLTAVKDVNEVMERHIDDSLAIIPPIKNSYTSHCDSSCNSNLKLVDVGTGAGLPGLVLAIACPDWKVTLLESMNKRCVFLEHAVSLTQLLNVQIVRGRAETLGKDVSFREQYDVAVARAVAEMRILAEYCLPLVRVGGLFVAAKGHDPQEEVKNSERAVQLMGASLLQLCSVESQSPFGQRTAVVCLKSRRTPKKYPRDPGTPAKVPL
cccccccccccHHHHHHHHHHHHHHHHHHHHccccccEEcccHHHHHHHHHHHcccccccccccccccccccccccccEEEEccccccccHHHHHHccccEEEEEEccHHHHHHHHHHHHHHccccEEEEEEccccccccccccccccEEEEEccccHHHHHHHHccccccccEEEEEcccccHHHHHHHHHHHHHHccEEEEEEEEEcccccccCEEEEEEECccccccccccccccccccc
MPFFNGTGYPFSVFMFMFFYLGLFLKKRKQNLQKMNLTAVKDVNEVMERHIDDSLAIIPPIKNSYTSHCDSSCNSNLKLVDVGTGAGLPGLVLAIACPDWKVTLLESMNKRCVFLEHAVSLTQLLNVQIVRGRAETLGKDVSFREQYDVAVARAVAEMRILAEYCLPLVRVGGLFVAAKGHDPQEEVKNSERAVQLMGASLLQLCSVESQSPFGQRTAVVCLKSRRTPKKYPRD*********
xxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPFFNGTGYPFSVFMFMFFYLGLFLKKRKQNLQKMNLTAVKDVNEVMERHIDDSLAIIPPIKNSYTSHCDSSCNSNLKLVDVGTGAGLPGLVLAIACPDWKVTLLESMNKRCVFLEHAVSLTQLLNVQIVRGRAETLGKDVSFREQYDVAVARAVAEMRILAEYCLPLVRVGGLFVAAKGHDPQEEVKNSERAVQLMGASLLQLCSVESQSPFGQRTAVVCLKSRRTPKKYPRDPGTPAKVPL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ribosomal RNA small subunit methyltransferase G Specifically methylates the N7 position of guanosine in position 535 of 16S rRNA.probableQ6G5W6
Ribosomal RNA small subunit methyltransferase G Specifically methylates the N7 position of guanosine in position 535 of 16S rRNA.probableQ81JH4
Ribosomal RNA small subunit methyltransferase G Specifically methylates the N7 position of guanosine in position 535 of 16S rRNA.probableQ2YZC0

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.1.-.-Transferring one-carbon groups.probable
2.1.1.-15-hydroxyprostaglandin-I dehydrogenase (NADP(+)).probable
2.1.1.17016S rRNA (guanine(527)-N(7))-methyltransferase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1XDZ, chain A
Confidence level:very confident
Coverage over the Query: 12-62,73-243
View the alignment between query and template
View the model in PyMOL
Template: 3UWP, chain A
Confidence level:confident
Coverage over the Query: 2-179
View the alignment between query and template
View the model in PyMOL