Citrus Sinensis ID: 026125

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240---
MAEQHVSLKRVQVAQPKHLFKQTQLLVTLTQHYSRILNNSNMSFSRINRARPLLVRCMSNIPENSVYGGPKPQNPNQRVTLTHLRQKHKNGEPITMVTAYDYPSAVHLDSAGIDICLVGDSAAMVVHGHDTTLPITLEEMLVHCRAVARGAKRPLLVGDLPFGTYESSTNQAVDTAVRILKEGGMDAIKLEGGSPSRITAARGIVEAGIAVMGHVGLTPQAISVLGGFRPQGKNVTSAVKVFI
cccccccccccccccccHHHHHccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccEEEEEccccHHHHHHHHccccEEEEcccHHHHcccccccccccHHHHHHHHHHHHHcccccEEEECcccccccccHHHHHHHHHHHHHHHcccEEEcccccccHHHHHHHHHHcccccEEcccccccccccccccccccccHHHHHcccc
************VAQPKHLFKQTQLLVTLTQHYSRILNNSNMSFSRINRARPLLVRCMSNI********************THLRQKHKNGEPITMVTAYDYPSAVHLDSAGIDICLVGDSAAMVVHGHDTTLPITLEEMLVHCRAVARGAKRPLLVGDLPFGTYESSTNQAVDTAVRILKEGGMDAIKLEGGSPSRITAARGIVEAGIAVMGHVGLTPQAISVLGGFRPQGKNVT**VKVFI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEQHVSLKRVQVAQPKHLFKQTQLLVTLTQHYSRILNNSNMSFSRINRARPLLVRCMSNIPENSVYGGPKPQNPNQRVTLTHLRQKHKNGEPITMVTAYDYPSAVHLDSAGIDICLVGDSAAMVVHGHDTTLPITLEEMLVHCRAVARGAKRPLLVGDLPFGTYESSTNQAVDTAVRILKEGGMDAIKLEGGSPSRITAARGIVEAGIAVMGHVGLTPQAISVLGGFRPQGKNVTSAVKVFI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
3-methyl-2-oxobutanoate hydroxymethyltransferase Catalyzes the reversible reaction in which hydroxymethyl group from 5,10-methylenetetrahydrofolate is tranferred onto alpha-ketoisovalerate to form ketopantoate.probableQ7NMK3
3-methyl-2-oxobutanoate hydroxymethyltransferase Catalyzes the reversible reaction in which hydroxymethyl group from 5,10-methylenetetrahydrofolate is tranferred onto alpha-ketoisovalerate to form ketopantoate.probableB8HWP9
3-methyl-2-oxobutanoate hydroxymethyltransferase Catalyzes the reversible reaction in which hydroxymethyl group from 5,10-methylenetetrahydrofolate is tranferred onto alpha-ketoisovalerate to form ketopantoate.probableQ5YZ95

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1OY0, chain A
Confidence level:very confident
Coverage over the Query: 76-219,234-242
View the alignment between query and template
View the model in PyMOL