Citrus Sinensis ID: 026130

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240---
MRRRPAAGASTSSAGAAEVEETIEGSDDEGVAGGHYEAKASKKKEKRRQEREAAQQADEAARESRQSKQDRYTEMRRRKDEEREARESALEEEAKAQKAREEEAAAFEFEKWKGEFSIDAEGTTENEVQDGDRDLLADFVEYIKKHKCIPLEDLAAEFKLRTQECINRITSLENMGRLSGVMDDRGKYIYISQAEMKAVADYIKRQGRVSISHLASKSNQFIDLETKAQFVEDLSGVEEISVA
ccccccccccccccccHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHcccccHHHHHHHccccHHHHHHHHHHHHHcccccEEEEccccEEEEcHHHHHHHHHHHHHcccccHHHHHHHcccccccccHHHHHHHHHHHHHHHcc
cccccccccccccccHHHHHHccccccHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcEEccccccccccHHHHHHHHHHHHHHHHHccEEEHHHHHHHccccHHHHHHHHHHHHHcccEEEEEcccccEEEEcHHHHHHHHHHHHHcccccHHHHHHHHccHEccccccccHHHHccHHHHHcc
mrrrpaagastssagaaeveetiegsddegvagghyeaKASKKKEKRRQEREAAQQADEAARESRQSKQDRYTEMRRRKDEEREARESALEEEAKAQKAREEEAAAFEFEkwkgefsidaegttenevqdgdRDLLADFVEYIKkhkcipleDLAAEFKLRTQECINRITSLenmgrlsgvmddrgkYIYISQAEMKAVADYIKRQGRVSISHLASKSNQFIDLETKAQFVEdlsgveeisva
mrrrpaagastssagaaeveetiegsddegvagghyeakaskkkekrRQEREAAQqadeaaresrqskqdrytemrrrkdeereaRESALEEEAKAQKAREEEAAAFEFEkwkgefsidaegttenevqdgdRDLLADFVEYIKKHKCIPLEDLAAEFKLRTQECINritslenmgrlsgvMDDRGKYIYISQAEMKAVADYIKRQGRVSISHLASKSNQFIDLETKAQFvedlsgveeisva
MRRRPaagastssagaaEVEETIEGSDDEGVAGGHYeakaskkkekrrqereaaqqadeaaresrqSKQDRYTemrrrkdeerearesaleeeakaqkareeeaaafefekwkgefSIDAEGTTENEVQDGDRDLLADFVEYIKKHKCIPLEDLAAEFKLRTQECINRITSLENMGRLSGVMDDRGKYIYISQAEMKAVADYIKRQGRVSISHLASKSNQFIDLETKAQFVEDLSGVEEISVA
************************************************************************************************************FEKWKGEFS**************DRDLLADFVEYIKKHKCIPLEDLAAEFKLRTQECINRITSLENMGRLSGVMDDRGKYIYISQAEMKAVADYIKRQGRVSISHLASKSNQFIDLETKAQFV************
*************************************************************************************************************************************DLLADFVEYIKKHKCIPLEDLAAEFKLRTQECINRITSLENMGRLSGVMDDRGKYIYISQAEMKAVADYIKRQGRVSISHLASKSNQFIDLETKAQF***LSGVEEI***
***************************DEGVAGGHY********************************************************************AAFEFEKWKGEFSIDAEGTTENEVQDGDRDLLADFVEYIKKHKCIPLEDLAAEFKLRTQECINRITSLENMGRLSGVMDDRGKYIYISQAEMKAVADYIKRQGRVSISHLASKSNQFIDLETKAQFVEDLSGVEEISVA
******************************************************************************************************EAAAFEFEKWKGEFSIDAE*T*ENEVQDGDRDLLADFVEYIKKHKCIPLEDLAAEFKLRTQECINRITSLENMGRLSGVMDDRGKYIYISQAEMKAVADYIKRQGRVSISHLASKSNQFIDLETKAQF**DLSGVEE****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRRRPAAGASTSSAGAAEVEETIEGSDDEGVAGGHYEAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEAAAFEFEKWKGEFSIDAEGTTENEVQDGDRDLLADFVEYIKKHKCIPLEDLAAEFKLRTQECINRITSLENMGRLSGVMDDRGKYIYISQAEMKAVADYIKRQGRVSISHLASKSNQFIDLETKAQFVEDLSGVEEISVA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query243 2.2.26 [Sep-21-2011]
Q8LH03302 DDRGK domain-containing p no no 0.806 0.649 0.729 1e-72
Q94C53298 DDRGK domain-containing p yes no 0.917 0.748 0.746 4e-70
B3S3D5310 DDRGK domain-containing p N/A no 0.543 0.425 0.485 5e-31
C0KYB6289 DDRGK domain-containing p N/A no 0.502 0.422 0.543 2e-30
B4LYB9307 DDRGK domain-containing p N/A no 0.489 0.387 0.525 9e-30
Q9VDD1309 DDRGK domain-containing p yes no 0.473 0.372 0.517 3e-29
C3Y431298 DDRGK domain-containing p yes no 0.481 0.392 0.512 4e-29
Q295B1309 DDRGK domain-containing p yes no 0.473 0.372 0.525 1e-28
B4GMC4309 DDRGK domain-containing p N/A no 0.473 0.372 0.525 1e-28
B4KB40310 DDRGK domain-containing p N/A no 0.489 0.383 0.516 1e-28
>sp|Q8LH03|DDRGK_ORYSJ DDRGK domain-containing protein 1 OS=Oryza sativa subsp. japonica GN=Os07g0103200 PE=2 SV=1 Back     alignment and function desciption
 Score =  272 bits (696), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 143/196 (72%), Positives = 172/196 (87%)

Query: 38  AKASKKKEKRRQEREAAQQADEAARESRQSKQDRYTEMRRRKDEEREARESALEEEAKAQ 97
            + SKKKEK+RQ+REA +QA+EAAR+SR++KQDRY EMRR+KDEEREA+E  +EEEA+A+
Sbjct: 94  PRGSKKKEKKRQDREAQRQAEEAARDSRRTKQDRYAEMRRKKDEEREAQERLMEEEARAR 153

Query: 98  KAREEEAAAFEFEKWKGEFSIDAEGTTENEVQDGDRDLLADFVEYIKKHKCIPLEDLAAE 157
           KA+EEEAAA EFEKWKG FS+DAEGTTE++ QD  + LL +FVEYIK  KC+PLEDLAAE
Sbjct: 154 KAKEEEAAALEFEKWKGAFSVDAEGTTESDTQDDGQGLLHNFVEYIKNQKCVPLEDLAAE 213

Query: 158 FKLRTQECINRITSLENMGRLSGVMDDRGKYIYISQAEMKAVADYIKRQGRVSISHLASK 217
           F++RTQ+CINRI +LE M RLSGVMDDRGK+IYIS  EMKAVADYI++QGRVSISHLAS 
Sbjct: 214 FRMRTQDCINRIITLEGMDRLSGVMDDRGKFIYISTEEMKAVADYIRKQGRVSISHLASN 273

Query: 218 SNQFIDLETKAQFVED 233
           SNQFIDLE K Q+ E+
Sbjct: 274 SNQFIDLEPKPQYNEE 289

Oryza sativa subsp. japonica (taxid: 39947)
>sp|Q94C53|DDRGK_ARATH DDRGK domain-containing protein 1 OS=Arabidopsis thaliana GN=At4g27120 PE=2 SV=1 Back     alignment and function description
>sp|B3S3D5|DDRGK_TRIAD DDRGK domain-containing protein 1 OS=Trichoplax adhaerens GN=TRIADDRAFT_58679 PE=3 SV=1 Back     alignment and function description
>sp|C0KYB6|DDRGK_BOMMO DDRGK domain-containing protein 1 OS=Bombyx mori PE=2 SV=1 Back     alignment and function description
>sp|B4LYB9|DDRGK_DROVI DDRGK domain-containing protein 1 OS=Drosophila virilis GN=GJ23857 PE=3 SV=1 Back     alignment and function description
>sp|Q9VDD1|DDRGK_DROME DDRGK domain-containing protein 1 OS=Drosophila melanogaster GN=CG5862 PE=1 SV=1 Back     alignment and function description
>sp|C3Y431|DDRGK_BRAFL DDRGK domain-containing protein 1 OS=Branchiostoma floridae GN=BRAFLDRAFT_114851 PE=3 SV=1 Back     alignment and function description
>sp|Q295B1|DDRGK_DROPS DDRGK domain-containing protein 1 OS=Drosophila pseudoobscura pseudoobscura GN=GA19186 PE=3 SV=1 Back     alignment and function description
>sp|B4GMC4|DDRGK_DROPE DDRGK domain-containing protein 1 OS=Drosophila persimilis GN=GL12371 PE=3 SV=1 Back     alignment and function description
>sp|B4KB40|DDRGK_DROMO DDRGK domain-containing protein 1 OS=Drosophila mojavensis GN=GI22611 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query243
359494005297 PREDICTED: DDRGK domain-containing prote 0.995 0.814 0.802 1e-106
224124254298 predicted protein [Populus trichocarpa] 0.995 0.812 0.765 2e-93
255563717300 conserved hypothetical protein [Ricinus 0.925 0.75 0.764 1e-82
357452749296 DDRGK domain-containing protein [Medicag 0.868 0.712 0.788 5e-82
356549837299 PREDICTED: DDRGK domain-containing prote 0.967 0.785 0.766 7e-81
388508552296 unknown [Medicago truncatula] 0.868 0.712 0.778 1e-80
343173127293 DDRGK domain-containing protein, partial 0.971 0.805 0.758 1e-78
343173129293 DDRGK domain-containing protein, partial 0.971 0.805 0.741 3e-77
356543938299 PREDICTED: DDRGK domain-containing prote 0.967 0.785 0.771 7e-77
242047110307 hypothetical protein SORBIDRAFT_02g00045 0.794 0.628 0.751 2e-72
>gi|359494005|ref|XP_003634707.1| PREDICTED: DDRGK domain-containing protein 1-like [Vitis vinifera] gi|297735965|emb|CBI23939.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 195/243 (80%), Positives = 217/243 (89%), Gaps = 1/243 (0%)

Query: 1   MRRRPAAGASTSSAGAAEVEETIEGSDDEGVAGGHYEAKASKKKEKRRQEREAAQQADEA 60
           MRRRPA+GASTSSA  A VEE ++ SD E VA   YEAK SKK+E++RQEREA +QADEA
Sbjct: 56  MRRRPASGASTSSAPTATVEEIVDESD-EDVAVDEYEAKHSKKRERKRQEREAQRQADEA 114

Query: 61  ARESRQSKQDRYTEMRRRKDEEREARESALEEEAKAQKAREEEAAAFEFEKWKGEFSIDA 120
           ARESR +KQDRY E RRRKDEEREA+E  LEEEAKAQKA+E+EAAA EFEKWKGEFS+DA
Sbjct: 115 ARESRLTKQDRYAETRRRKDEEREAKERQLEEEAKAQKAKEDEAAALEFEKWKGEFSVDA 174

Query: 121 EGTTENEVQDGDRDLLADFVEYIKKHKCIPLEDLAAEFKLRTQECINRITSLENMGRLSG 180
           EGTTENE+QDG++ LL DFVEYIKK KC+PLEDLAAEFKLRTQ+CINRITSLENMGRLSG
Sbjct: 175 EGTTENEMQDGNQGLLVDFVEYIKKQKCVPLEDLAAEFKLRTQDCINRITSLENMGRLSG 234

Query: 181 VMDDRGKYIYISQAEMKAVADYIKRQGRVSISHLASKSNQFIDLETKAQFVEDLSGVEEI 240
           VMDDRGK+IYISQ EM AVADYIKRQGRVSISHLASKSNQFIDLE KAQ V+D+SGVEE+
Sbjct: 235 VMDDRGKFIYISQEEMHAVADYIKRQGRVSISHLASKSNQFIDLEPKAQVVDDISGVEEM 294

Query: 241 SVA 243
           +V 
Sbjct: 295 AVT 297

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224124254|ref|XP_002319285.1| predicted protein [Populus trichocarpa] gi|118486501|gb|ABK95090.1| unknown [Populus trichocarpa] gi|222857661|gb|EEE95208.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255563717|ref|XP_002522860.1| conserved hypothetical protein [Ricinus communis] gi|223537944|gb|EEF39558.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|357452749|ref|XP_003596651.1| DDRGK domain-containing protein [Medicago truncatula] gi|355485699|gb|AES66902.1| DDRGK domain-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356549837|ref|XP_003543297.1| PREDICTED: DDRGK domain-containing protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|388508552|gb|AFK42342.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|343173127|gb|AEL99266.1| DDRGK domain-containing protein, partial [Silene latifolia] Back     alignment and taxonomy information
>gi|343173129|gb|AEL99267.1| DDRGK domain-containing protein, partial [Silene latifolia] Back     alignment and taxonomy information
>gi|356543938|ref|XP_003540415.1| PREDICTED: DDRGK domain-containing protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|242047110|ref|XP_002461301.1| hypothetical protein SORBIDRAFT_02g000450 [Sorghum bicolor] gi|241924678|gb|EER97822.1| hypothetical protein SORBIDRAFT_02g000450 [Sorghum bicolor] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query243
TAIR|locus:2136457298 AT4G27120 "AT4G27120" [Arabido 0.518 0.422 0.798 4.8e-52
UNIPROTKB|E1BUR3308 DDRGK1 "Uncharacterized protei 0.469 0.370 0.508 9.7e-25
UNIPROTKB|F1MK36313 DDRGK1 "DDRGK domain-containin 0.460 0.357 0.482 2.1e-22
MGI|MGI:1924256315 Ddrgk1 "DDRGK domain containin 0.432 0.333 0.485 2.1e-22
UNIPROTKB|Q1LZB0313 DDRGK1 "DDRGK domain-containin 0.448 0.348 0.495 5.5e-22
ZFIN|ZDB-GENE-040426-1050300 ddrgk1 "DDRGK domain containin 0.440 0.356 0.476 9e-22
UNIPROTKB|F1S8B0312 DDRGK1 "Uncharacterized protei 0.432 0.336 0.476 1.5e-21
UNIPROTKB|Q96HY6314 DDRGK1 "DDRGK domain-containin 0.432 0.334 0.466 1.9e-21
UNIPROTKB|E2QZV2390 DDRGK1 "Uncharacterized protei 0.432 0.269 0.466 4.7e-21
WB|WBGene00022865302 ZK1236.7a [Caenorhabditis eleg 0.448 0.360 0.427 8e-21
TAIR|locus:2136457 AT4G27120 "AT4G27120" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 510 (184.6 bits), Expect = 4.8e-52, Sum P(2) = 4.8e-52
 Identities = 103/129 (79%), Positives = 115/129 (89%)

Query:   117 SIDAEGTTENEVQDGDRDLLADFVEYIKKHKCIPLEDLAAEFKLRTQECINRITSLENMG 176
             S+DAEGTTE EVQ G++DLL++FVEYIKK KC+PLEDLAAEF LRTQECINRI SLE++G
Sbjct:   171 SVDAEGTTE-EVQGGNQDLLSEFVEYIKKQKCVPLEDLAAEFHLRTQECINRIASLESIG 229

Query:   177 RLSGVMDDRGKYIYISQAEMKAVADYIKRQGRVSISHLASKSNQFIDLETKAQ--FVEDL 234
             RLSGVMDDRGKYIYIS  EM AVADYIKRQGRVSISHLASKSNQFIDLE K Q    E++
Sbjct:   230 RLSGVMDDRGKYIYISMEEMNAVADYIKRQGRVSISHLASKSNQFIDLEPKVQHQLTEEI 289

Query:   235 SGVEEISVA 243
             SG+EEISV+
Sbjct:   290 SGMEEISVS 298
GO:0030244 "cellulose biosynthetic process" evidence=RCA
GO:0048193 "Golgi vesicle transport" evidence=RCA
UNIPROTKB|E1BUR3 DDRGK1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MK36 DDRGK1 "DDRGK domain-containing protein 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1924256 Ddrgk1 "DDRGK domain containing 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q1LZB0 DDRGK1 "DDRGK domain-containing protein 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1050 ddrgk1 "DDRGK domain containing 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1S8B0 DDRGK1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q96HY6 DDRGK1 "DDRGK domain-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2QZV2 DDRGK1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
WB|WBGene00022865 ZK1236.7a [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q94C53DDRGK_ARATHNo assigned EC number0.74670.91760.7483yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query243
pfam09756189 pfam09756, DDRGK, DDRGK domain 8e-39
TIGR02680 1353 TIGR02680, TIGR02680, TIGR02680 family protein 0.001
PRK12678 672 PRK12678, PRK12678, transcription termination fact 0.004
>gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain Back     alignment and domain information 
 Score =  132 bits (335), Expect = 8e-39
 Identities = 74/183 (40%), Positives = 113/183 (61%)

Query: 41  SKKKEKRRQEREAAQQADEAARESRQSKQDRYTEMRRRKDEEREARESALEEEAKAQKAR 100
            + K + +Q R   ++A+E  RE R+  +++    R+ ++E  E RE   EEE + ++  
Sbjct: 7   KRAKLEEKQARRQQREAEEEEREERKKLEEKREGERKEEEELEEEREKKKEEEERKEREE 66

Query: 101 EEEAAAFEFEKWKGEFSIDAEGTTENEVQDGDRDLLADFVEYIKKHKCIPLEDLAAEFKL 160
           +      E+EK K  F ++ EGT +    +   +LL DF+ YIK  K + LE+L+AEF L
Sbjct: 67  QARKEQEEYEKLKSSFVVEEEGTDKLSADEESNELLEDFINYIKLKKVVNLEELSAEFGL 126

Query: 161 RTQECINRITSLENMGRLSGVMDDRGKYIYISQAEMKAVADYIKRQGRVSISHLASKSNQ 220
           +T++ I RI  LE  G ++GV+DDRGKYIYIS  E++AVA +I ++GRVSIS LA  SN+
Sbjct: 127 KTEDVIERIQDLEAQGSITGVIDDRGKYIYISPEELEAVASFINKRGRVSISELAEISNK 186

Query: 221 FID 223
            I 
Sbjct: 187 LIS 189

This is a family of proteins of approximately 300 residues, found in plants and vertebrates. They contain a highly conserved DDRGK motif. Length = 189
>gnl|CDD|233973 TIGR02680, TIGR02680, TIGR02680 family protein Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 243
KOG3054299 consensus Uncharacterized conserved protein [Funct 100.0
PF09756188 DDRGK: DDRGK domain; InterPro: IPR019153 This is a 100.0
smart0008888 PINT motif in proteasome subunits, Int-6, Nip-1 an 97.45
smart0075388 PAM PCI/PINT associated module. 97.45
smart0041866 HTH_ARSR helix_turn_helix, Arsenical Resistance Op 97.28
PF0901269 FeoC: FeoC like transcriptional regulator; InterPr 97.03
PF01399105 PCI: PCI domain; InterPro: IPR000717 A homology do 96.89
PF0822057 HTH_DeoR: DeoR-like helix-turn-helix domain; Inter 96.21
cd0009078 HTH_ARSR Arsenical Resistance Operon Repressor and 96.2
PF1346368 HTH_27: Winged helix DNA-binding domain; PDB: 3GFL 96.03
PRK03902142 manganese transport transcriptional regulator; Pro 96.03
TIGR02337118 HpaR homoprotocatechuate degradation operon regula 95.98
smart00347101 HTH_MARR helix_turn_helix multiple antibiotic resi 95.92
smart00344108 HTH_ASNC helix_turn_helix ASNC type. AsnC: an auto 95.91
PRK14165 217 winged helix-turn-helix domain-containing protein/ 95.85
PRK06266178 transcription initiation factor E subunit alpha; V 95.79
KOG3054299 consensus Uncharacterized conserved protein [Funct 95.75
PF09743 272 DUF2042: Uncharacterized conserved protein (DUF204 95.39
cd0737766 WHTH_GntR Winged helix-turn-helix (WHTH) DNA-bindi 95.27
PRK11169164 leucine-responsive transcriptional regulator; Prov 94.91
smart0042053 HTH_DEOR helix_turn_helix, Deoxyribose operon repr 94.68
TIGR01884203 cas_HTH CRISPR locus-related DNA-binding protein. 94.61
smart0034560 HTH_GNTR helix_turn_helix gluconate operon transcr 94.22
TIGR01889109 Staph_reg_Sar staphylococcal accessory regulator f 94.08
PF1341248 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 93.81
PF0827955 HTH_11: HTH domain; InterPro: IPR013196 Winged hel 93.77
PRK11179153 DNA-binding transcriptional regulator AsnC; Provis 93.76
PF03297105 Ribosomal_S25: S25 ribosomal protein; InterPro: IP 93.69
PLN03083 803 E3 UFM1-protein ligase 1 homolog; Provisional 93.65
COG1349 253 GlpR Transcriptional regulators of sugar metabolis 93.64
PRK11512144 DNA-binding transcriptional repressor MarR; Provis 93.53
COG1522154 Lrp Transcriptional regulators [Transcription] 93.32
PRK03573144 transcriptional regulator SlyA; Provisional 93.08
PF1351852 HTH_28: Helix-turn-helix domain 93.05
PF0470362 FaeA: FaeA-like protein; PDB: 2JT1_A 2HTJ_A. 93.0
smart0034691 HTH_ICLR helix_turn_helix isocitrate lyase regulat 92.74
PF13551112 HTH_29: Winged helix-turn helix 92.57
PTZ00266 1021 NIMA-related protein kinase; Provisional 92.39
PRK10434 256 srlR DNA-bindng transcriptional repressor SrlR; Pr 91.96
PF0172665 LexA_DNA_bind: LexA DNA binding domain; InterPro: 91.82
KOG1144 1064 consensus Translation initiation factor 5B (eIF-5B 91.76
PRK0933486 30S ribosomal protein S25e; Provisional 91.53
PRK09954 362 putative kinase; Provisional 91.48
PF0197868 TrmB: Sugar-specific transcriptional regulator Trm 91.26
TIGR0012269 birA_repr_reg BirA biotin operon repressor domain. 91.17
TIGR02702203 SufR_cyano iron-sulfur cluster biosynthesis transc 91.07
PRK13777185 transcriptional regulator Hpr; Provisional 90.78
PRK10870176 transcriptional repressor MprA; Provisional 90.72
TIGR02944130 suf_reg_Xantho FeS assembly SUF system regulator, 90.7
PF1284061 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_ 90.44
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 90.42
PRK13509 251 transcriptional repressor UlaR; Provisional 90.32
PF08784102 RPA_C: Replication protein A C terminal; InterPro: 90.25
cd0476149 HTH_MerR-SF Helix-Turn-Helix DNA binding domain of 90.23
TIGR0176449 excise DNA binding domain, excisionase family. An 89.84
PRK1543178 ferrous iron transport protein FeoC; Provisional 89.55
PF11600216 CAF-1_p150: Chromatin assembly factor 1 complex p1 89.47
PRK00441149 argR arginine repressor; Provisional 89.14
PRK09802 269 DNA-binding transcriptional regulator AgaR; Provis 88.95
PF09743 272 DUF2042: Uncharacterized conserved protein (DUF204 88.88
PRK10411 240 DNA-binding transcriptional activator FucR; Provis 88.39
PF1340442 HTH_AsnC-type: AsnC-type helix-turn-helix domain; 88.2
PRK10906 252 DNA-binding transcriptional repressor GlpR; Provis 88.09
smart0055068 Zalpha Z-DNA-binding domain in adenosine deaminase 88.05
PF01710119 HTH_Tnp_IS630: Transposase; InterPro: IPR002622 Tr 88.03
PRK04424185 fatty acid biosynthesis transcriptional regulator; 87.95
PF1494777 HTH_45: Winged helix-turn-helix; PDB: 1XSX_B 1R7J_ 87.77
PRK10681 252 DNA-binding transcriptional repressor DeoR; Provis 87.54
smart0042270 HTH_MERR helix_turn_helix, mercury resistance. 87.46
cd0476467 HTH_MlrA-like_sg1 Helix-Turn-Helix DNA binding dom 87.36
PRK04172 489 pheS phenylalanyl-tRNA synthetase subunit alpha; P 87.29
PF11600216 CAF-1_p150: Chromatin assembly factor 1 complex p1 87.11
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 87.04
smart0034284 HTH_ARAC helix_turn_helix, arabinose operon contro 87.0
cd0009267 HTH_CRP helix_turn_helix, cAMP Regulatory protein 86.99
PF12419141 DUF3670: SNF2 Helicase protein ; InterPro: IPR0221 86.98
COG1339214 Transcriptional regulator of a riboflavin/FAD bios 86.81
smart0041948 HTH_CRP helix_turn_helix, cAMP Regulatory protein. 86.6
PF0901269 FeoC: FeoC like transcriptional regulator; InterPr 86.59
PRK11050152 manganese transport regulator MntR; Provisional 86.49
COG1846126 MarR Transcriptional regulators [Transcription] 86.29
PF0344478 HrcA_DNA-bdg: Winged helix-turn-helix transcriptio 85.98
PF1272851 HTH_17: Helix-turn-helix domain 85.66
cd01106103 HTH_TipAL-Mta Helix-Turn-Helix DNA binding domain 85.51
TIGR00498199 lexA SOS regulatory protein LexA. LexA acts as a h 85.39
PF0132560 Fe_dep_repress: Iron dependent repressor, N-termin 85.25
PF1354576 HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: 85.18
smart0052996 HTH_DTXR Helix-turn-helix diphteria tox regulatory 84.95
PF1280262 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP 84.88
KOG2235 776 consensus Uncharacterized conserved protein [Funct 84.88
PF06163127 DUF977: Bacterial protein of unknown function (DUF 84.87
PRK00215205 LexA repressor; Validated 84.86
PF0039264 GntR: Bacterial regulatory proteins, gntR family; 84.44
PHA02943165 hypothetical protein; Provisional 84.15
PRK15002154 redox-sensitivie transcriptional activator SoxR; P 84.08
cd0476896 HTH_BmrR-like Helix-Turn-Helix DNA binding domain 84.0
PF0104759 MarR: MarR family; InterPro: IPR000835 The MarR-ty 83.92
PRK11886 319 bifunctional biotin--[acetyl-CoA-carboxylase] synt 83.27
cd04773108 HTH_TioE_rpt2 Second Helix-Turn-Helix DNA binding 83.26
PF05158 327 RNA_pol_Rpc34: RNA polymerase Rpc34 subunit; Inter 83.2
PF0102247 HTH_5: Bacterial regulatory protein, arsR family; 83.17
cd0478297 HTH_BltR Helix-Turn-Helix DNA binding domain of th 83.09
cd04783126 HTH_MerR1 Helix-Turn-Helix DNA binding domain of t 83.02
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 82.58
PF1449391 HTH_40: Helix-turn-helix domain 82.57
PRK03341168 arginine repressor; Provisional 82.39
cd0110588 HTH_GlnR-like Helix-Turn-Helix DNA binding domain 81.77
PRK10512614 selenocysteinyl-tRNA-specific translation factor; 81.73
PRK10141117 DNA-binding transcriptional repressor ArsR; Provis 81.61
PF1341169 MerR_1: MerR HTH family regulatory protein; PDB: 2 81.59
TIGR03338212 phnR_burk phosphonate utilization associated trans 81.33
COG4901107 Ribosomal protein S25 [Translation, ribosomal stru 81.19
PF1360180 HTH_34: Winged helix DNA-binding domain; PDB: 1UB9 80.98
PRK11414221 colanic acid/biofilm transcriptional regulator; Pr 80.63
>KOG3054 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information 
Probab=100.00  E-value=1.5e-72  Score=505.37  Aligned_cols=227  Identities=48%  Similarity=0.679  Sum_probs=188.8

Q ss_pred             CCCCCCC-CcCCCCCCccccccc--cCCCccccccCCcchhhhhhHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHH
Q 026130            1 MRRRPAA-GASTSSAGAAEVEET--IEGSDDEGVAGGHYEAKASKKKEKRRQEREAAQQADEAARESRQSKQDRYTEMRR   77 (243)
Q Consensus         1 ~r~~~~~-~~~~~~~~~~~~~~~--~~~~~~e~~~~g~~~~kk~~Kk~~kkqerk~qReaee~~REerk~~e~~~ee~rr   77 (243)
                      |||.|.+ +..+++.+.....++  .+++..+....+...++|+.+|++.||+|++||+++++.||+|+++++ +++..|
T Consensus        64 ~rrd~~~~~~va~~~sd~ee~~~~dg~ee~~e~~~~~~kigkkK~aKleakqerr~qRe~E~~eREeRk~ke~-~eE~er  142 (299)
T KOG3054|consen   64 MRRDPQAASGVASSTSDVEEEGSGDGDEEEPEAGGLQAKIGKKKEAKLEAKQERRAQREAEEAEREERKRKED-YEEAER  142 (299)
T ss_pred             cccChhhhccccccccccccccccccccccccccchhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHH-HHHHHH
Confidence            5666633 322333333222222  233333444455555566666777799999999999999999999999 567778


Q ss_pred             hhHHHHHHHH--HHHHHHHHHHHHHHHHHHHHHHhhhhccceecccccccccccccchhHHHHHHHHHHhcCccchHHHH
Q 026130           78 RKDEEREARE--SALEEEAKAQKAREEEAAAFEFEKWKGEFSIDAEGTTENEVQDGDRDLLADFVEYIKKHKCIPLEDLA  155 (243)
Q Consensus        78 kkeeere~eE--~~~eEeer~~kee~e~rE~eEY~kwK~~f~VEeeG~~~~~~~~~~~~lL~~Fi~yIK~~KvV~LEdLA  155 (243)
                      ++++++...|  ++.++.++++++++++++|+||+|||++|+|+++|+++. +.+...|||.+||+|||.+|||+|+|||
T Consensus       143 KkdEeR~~eEae~k~ee~~RkakEE~arkeheEylkmKaaFsVeeEGtee~-~~eeqdnll~eFv~YIk~nKvV~ledLa  221 (299)
T KOG3054|consen  143 KKDEERLAEEAELKEEEKERKAKEEEARKEHEEYLKMKAAFSVEEEGTEEV-QGEEQDNLLSEFVEYIKKNKVVPLEDLA  221 (299)
T ss_pred             hhhHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHhheeecccccccc-ccchHHHHHHHHHHHHHhcCeeeHHHHH
Confidence            8888875544  456888999999999999999999999999999999884 4555569999999999999999999999


Q ss_pred             HHcCCChHHHHHHHHHHHhcCCcceeeeCCCCeEEEcHHHHHHHHHHHHhcCCccHHHHHhhcccccccccchh
Q 026130          156 AEFKLRTQECINRITSLENMGRLSGVMDDRGKYIYISQAEMKAVADYIKRQGRVSISHLASKSNQFIDLETKAQ  229 (243)
Q Consensus       156 ~~F~lrtqd~I~RIq~Le~~g~LtGViDDRGKFIYIS~eEl~aVA~fI~~rGRVSi~eLa~~sN~lI~L~p~~~  229 (243)
                      ++|||+|||+|||||.|+++|+|||||||||||||||++||.+||+||+|||||||++||+.||+||+|.|...
T Consensus       222 s~f~Lrtqd~inriq~~l~eg~ltGVmDDRGKfIYIS~eEl~AVAkfIkqrGRVSIaelAe~SN~lI~l~~es~  295 (299)
T KOG3054|consen  222 SEFGLRTQDSINRIQELLAEGLLTGVMDDRGKFIYISMEELAAVAKFIKQRGRVSIAELAEKSNQLIDLETESP  295 (299)
T ss_pred             HHhCccHHHHHHHHHHHHHhhhheeeecCCCceEEecHHHHHHHHHHHHHcCceeHHHHHHhhcchhccccCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999987654

>PF09756 DDRGK: DDRGK domain; InterPro: IPR019153 This is a family of proteins of approximately 300 residues Back     alignment and domain information
>smart00088 PINT motif in proteasome subunits, Int-6, Nip-1 and TRIP-15 Back     alignment and domain information
>smart00753 PAM PCI/PINT associated module Back     alignment and domain information
>smart00418 HTH_ARSR helix_turn_helix, Arsenical Resistance Operon Repressor Back     alignment and domain information
>PF09012 FeoC: FeoC like transcriptional regulator; InterPro: IPR015102 This entry contains several transcriptional regulators, including FeoC, which contain a HTH motif Back     alignment and domain information
>PF01399 PCI: PCI domain; InterPro: IPR000717 A homology domain of unclear function, occurs in the C-terminal region of several regulatory components of the 26S proteasome as well as in other proteins Back     alignment and domain information
>PF08220 HTH_DeoR: DeoR-like helix-turn-helix domain; InterPro: IPR001034 The deoR-type HTH domain is a DNA-binding, helix-turn-helix (HTH) domain of about 50-60 amino acids present in transcription regulators of the deoR family, involved in sugar catabolism Back     alignment and domain information
>cd00090 HTH_ARSR Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors Back     alignment and domain information
>PF13463 HTH_27: Winged helix DNA-binding domain; PDB: 3GFL_A 2YR2_B 3GFM_A 3GFJ_A 3GF2_A 3GEZ_A 2GXG_A 3GFI_A 2EB7_A Back     alignment and domain information
>PRK03902 manganese transport transcriptional regulator; Provisional Back     alignment and domain information
>TIGR02337 HpaR homoprotocatechuate degradation operon regulator, HpaR Back     alignment and domain information
>smart00347 HTH_MARR helix_turn_helix multiple antibiotic resistance protein Back     alignment and domain information
>smart00344 HTH_ASNC helix_turn_helix ASNC type Back     alignment and domain information
>PRK14165 winged helix-turn-helix domain-containing protein/riboflavin kinase; Provisional Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>KOG3054 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09743 DUF2042: Uncharacterized conserved protein (DUF2042); InterPro: IPR018611 The ubiquitin fold modifier 1 (Ufm1) is the most recently discovered ubiquitin-like modifier whose conjugation (ufmylation) system is conserved in multicellular organisms Back     alignment and domain information
>cd07377 WHTH_GntR Winged helix-turn-helix (WHTH) DNA-binding domain of the GntR family of transcriptional regulators Back     alignment and domain information
>PRK11169 leucine-responsive transcriptional regulator; Provisional Back     alignment and domain information
>smart00420 HTH_DEOR helix_turn_helix, Deoxyribose operon repressor Back     alignment and domain information
>TIGR01884 cas_HTH CRISPR locus-related DNA-binding protein Back     alignment and domain information
>smart00345 HTH_GNTR helix_turn_helix gluconate operon transcriptional repressor Back     alignment and domain information
>TIGR01889 Staph_reg_Sar staphylococcal accessory regulator family Back     alignment and domain information
>PF13412 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A Back     alignment and domain information
>PF08279 HTH_11: HTH domain; InterPro: IPR013196 Winged helix DNA-binding proteins share a related winged helix-turn-helix DNA-binding motif, where the "wings", or loops, are small beta-sheets Back     alignment and domain information
>PRK11179 DNA-binding transcriptional regulator AsnC; Provisional Back     alignment and domain information
>PF03297 Ribosomal_S25: S25 ribosomal protein; InterPro: IPR004977 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PLN03083 E3 UFM1-protein ligase 1 homolog; Provisional Back     alignment and domain information
>COG1349 GlpR Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11512 DNA-binding transcriptional repressor MarR; Provisional Back     alignment and domain information
>COG1522 Lrp Transcriptional regulators [Transcription] Back     alignment and domain information
>PRK03573 transcriptional regulator SlyA; Provisional Back     alignment and domain information
>PF13518 HTH_28: Helix-turn-helix domain Back     alignment and domain information
>PF04703 FaeA: FaeA-like protein; PDB: 2JT1_A 2HTJ_A Back     alignment and domain information
>smart00346 HTH_ICLR helix_turn_helix isocitrate lyase regulation Back     alignment and domain information
>PF13551 HTH_29: Winged helix-turn helix Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>PRK10434 srlR DNA-bindng transcriptional repressor SrlR; Provisional Back     alignment and domain information
>PF01726 LexA_DNA_bind: LexA DNA binding domain; InterPro: IPR006199 This is the DNA binding domain of the LexA SOS regulon repressor which prevents expression of DNA repair proteins in bacteria Back     alignment and domain information
>KOG1144 consensus Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09334 30S ribosomal protein S25e; Provisional Back     alignment and domain information
>PRK09954 putative kinase; Provisional Back     alignment and domain information
>PF01978 TrmB: Sugar-specific transcriptional regulator TrmB; InterPro: IPR002831 TrmB, is a protein of 38,800 apparent molecular weight, that is involved in the maltose-specific regulation of the trehalose/maltose ABC transport operon in Thermococcus litoralis Back     alignment and domain information
>TIGR00122 birA_repr_reg BirA biotin operon repressor domain Back     alignment and domain information
>TIGR02702 SufR_cyano iron-sulfur cluster biosynthesis transcriptional regulator SufR Back     alignment and domain information
>PRK13777 transcriptional regulator Hpr; Provisional Back     alignment and domain information
>PRK10870 transcriptional repressor MprA; Provisional Back     alignment and domain information
>TIGR02944 suf_reg_Xantho FeS assembly SUF system regulator, gammaproteobacterial Back     alignment and domain information
>PF12840 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_A 1Y0U_B 2QUF_B 2QLZ_C 2OQG_B 2ZKZ_C 3PQK_A 3PQJ_D 3F6O_B Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK13509 transcriptional repressor UlaR; Provisional Back     alignment and domain information
>PF08784 RPA_C: Replication protein A C terminal; InterPro: IPR014892 This protein corresponds to the C-terminal of the single stranded DNA binding protein RPA (replication protein A) Back     alignment and domain information
>cd04761 HTH_MerR-SF Helix-Turn-Helix DNA binding domain of transcription regulators from the MerR superfamily Back     alignment and domain information
>TIGR01764 excise DNA binding domain, excisionase family Back     alignment and domain information
>PRK15431 ferrous iron transport protein FeoC; Provisional Back     alignment and domain information
>PF11600 CAF-1_p150: Chromatin assembly factor 1 complex p150 subunit, N-terminal; InterPro: IPR021644 P150 is a polypeptide subunit of CAF-1, which functions in depositing newly synthesised and acetylated histones H3/H4 into chromatin during DNA replication and repair [] Back     alignment and domain information
>PRK00441 argR arginine repressor; Provisional Back     alignment and domain information
>PRK09802 DNA-binding transcriptional regulator AgaR; Provisional Back     alignment and domain information
>PF09743 DUF2042: Uncharacterized conserved protein (DUF2042); InterPro: IPR018611 The ubiquitin fold modifier 1 (Ufm1) is the most recently discovered ubiquitin-like modifier whose conjugation (ufmylation) system is conserved in multicellular organisms Back     alignment and domain information
>PRK10411 DNA-binding transcriptional activator FucR; Provisional Back     alignment and domain information
>PF13404 HTH_AsnC-type: AsnC-type helix-turn-helix domain; PDB: 2ZNY_E 2ZNZ_G 1RI7_A 2CYY_A 2E1C_A 2VC1_B 2QZ8_A 2W29_C 2IVM_B 2VBX_B Back     alignment and domain information
>PRK10906 DNA-binding transcriptional repressor GlpR; Provisional Back     alignment and domain information
>smart00550 Zalpha Z-DNA-binding domain in adenosine deaminases Back     alignment and domain information
>PF01710 HTH_Tnp_IS630: Transposase; InterPro: IPR002622 Transposase proteins are necessary for efficient DNA transposition Back     alignment and domain information
>PRK04424 fatty acid biosynthesis transcriptional regulator; Provisional Back     alignment and domain information
>PF14947 HTH_45: Winged helix-turn-helix; PDB: 1XSX_B 1R7J_A Back     alignment and domain information
>PRK10681 DNA-binding transcriptional repressor DeoR; Provisional Back     alignment and domain information
>smart00422 HTH_MERR helix_turn_helix, mercury resistance Back     alignment and domain information
>cd04764 HTH_MlrA-like_sg1 Helix-Turn-Helix DNA binding domain of putative MlrA-like transcription regulators Back     alignment and domain information
>PRK04172 pheS phenylalanyl-tRNA synthetase subunit alpha; Provisional Back     alignment and domain information
>PF11600 CAF-1_p150: Chromatin assembly factor 1 complex p150 subunit, N-terminal; InterPro: IPR021644 P150 is a polypeptide subunit of CAF-1, which functions in depositing newly synthesised and acetylated histones H3/H4 into chromatin during DNA replication and repair [] Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00342 HTH_ARAC helix_turn_helix, arabinose operon control protein Back     alignment and domain information
>cd00092 HTH_CRP helix_turn_helix, cAMP Regulatory protein C-terminus; DNA binding domain of prokaryotic regulatory proteins belonging to the catabolite activator protein family Back     alignment and domain information
>PF12419 DUF3670: SNF2 Helicase protein ; InterPro: IPR022138 This domain family is found in bacteria, archaea and eukaryotes, and is approximately 140 amino acids in length Back     alignment and domain information
>COG1339 Transcriptional regulator of a riboflavin/FAD biosynthetic operon [Transcription / Coenzyme metabolism] Back     alignment and domain information
>smart00419 HTH_CRP helix_turn_helix, cAMP Regulatory protein Back     alignment and domain information
>PF09012 FeoC: FeoC like transcriptional regulator; InterPro: IPR015102 This entry contains several transcriptional regulators, including FeoC, which contain a HTH motif Back     alignment and domain information
>PRK11050 manganese transport regulator MntR; Provisional Back     alignment and domain information
>COG1846 MarR Transcriptional regulators [Transcription] Back     alignment and domain information
>PF03444 HrcA_DNA-bdg: Winged helix-turn-helix transcription repressor, HrcA DNA-binding; InterPro: IPR005104 Prokaryotic cells have a defence mechanism against a sudden heat-shock stress Back     alignment and domain information
>PF12728 HTH_17: Helix-turn-helix domain Back     alignment and domain information
>cd01106 HTH_TipAL-Mta Helix-Turn-Helix DNA binding domain of the transcription regulators TipAL, Mta, and SkgA Back     alignment and domain information
>TIGR00498 lexA SOS regulatory protein LexA Back     alignment and domain information
>PF01325 Fe_dep_repress: Iron dependent repressor, N-terminal DNA binding domain; InterPro: IPR022687 The DtxR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 65 residues present in metalloregulators of the DtxR/MntR family Back     alignment and domain information
>PF13545 HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: 3LA2_A 3LA3_B 3LA7_A 3B02_A 3E97_A 2H6C_B 1OMI_A 2BGC_H 2BEO_A 2GAU_A Back     alignment and domain information
>smart00529 HTH_DTXR Helix-turn-helix diphteria tox regulatory element Back     alignment and domain information
>PF12802 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP4_B 3KP2_A 3KP5_A 3KP3_B 3KP7_A 3NQO_B 3K0L_B Back     alignment and domain information
>KOG2235 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06163 DUF977: Bacterial protein of unknown function (DUF977); InterPro: IPR010382 This entry consists of several hypothetical bacterial proteins of unknown function Back     alignment and domain information
>PRK00215 LexA repressor; Validated Back     alignment and domain information
>PF00392 GntR: Bacterial regulatory proteins, gntR family; InterPro: IPR000524 Many bacterial transcription regulation proteins bind DNA through a helix-turn-helix (HTH) motif, which can be classified into subfamilies on the basis of sequence similarities Back     alignment and domain information
>PHA02943 hypothetical protein; Provisional Back     alignment and domain information
>PRK15002 redox-sensitivie transcriptional activator SoxR; Provisional Back     alignment and domain information
>cd04768 HTH_BmrR-like Helix-Turn-Helix DNA binding domain of BmrR-like transcription regulators Back     alignment and domain information
>PF01047 MarR: MarR family; InterPro: IPR000835 The MarR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 135 amino acids present in transcription regulators of the MarR/SlyA family, involved in the development of antibiotic resistance Back     alignment and domain information
>PRK11886 bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin operon repressor; Provisional Back     alignment and domain information
>cd04773 HTH_TioE_rpt2 Second Helix-Turn-Helix DNA binding domain of the regulatory protein TioE Back     alignment and domain information
>PF05158 RNA_pol_Rpc34: RNA polymerase Rpc34 subunit; InterPro: IPR007832 The family comprises a subunit specific to RNA Pol III, the tRNA specific polymerase Back     alignment and domain information
>PF01022 HTH_5: Bacterial regulatory protein, arsR family; InterPro: IPR001845 Bacterial transcription regulatory proteins that bind DNA via a helix-turn-helix (HTH) motif can be grouped into families on the basis of sequence similarities Back     alignment and domain information
>cd04782 HTH_BltR Helix-Turn-Helix DNA binding domain of the BltR transcription regulator Back     alignment and domain information
>cd04783 HTH_MerR1 Helix-Turn-Helix DNA binding domain of the MerR1 transcription regulator Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>PF14493 HTH_40: Helix-turn-helix domain Back     alignment and domain information
>PRK03341 arginine repressor; Provisional Back     alignment and domain information
>cd01105 HTH_GlnR-like Helix-Turn-Helix DNA binding domain of GlnR-like transcription regulators Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>PRK10141 DNA-binding transcriptional repressor ArsR; Provisional Back     alignment and domain information
>PF13411 MerR_1: MerR HTH family regulatory protein; PDB: 2JML_A 3GP4_A 3GPV_B Back     alignment and domain information
>TIGR03338 phnR_burk phosphonate utilization associated transcriptional regulator Back     alignment and domain information
>COG4901 Ribosomal protein S25 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF13601 HTH_34: Winged helix DNA-binding domain; PDB: 1UB9_A Back     alignment and domain information
>PRK11414 colanic acid/biofilm transcriptional regulator; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query243
1wi9_A72 Solution Structure Of The Pci Domain From Mouse Hyp 5e-14
>pdb|1WI9|A Chain A, Solution Structure Of The Pci Domain From Mouse Hypothetical Protein Aah51541 Length = 72 Back     alignment and structure 
Iteration: 1

 Score = 74.3 bits (181), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 44/64 (68%)
Query: 131 GDRDLLADFVEYIKKHKCIPLEDLAAEFKLRTQECINRITSLENMGRLSGVMDDRGKYIY 190
           G    L +F+ YIKK K + LEDLA +  LRTQ+ INRI  L   G L+GV+DDRGK+IY
Sbjct: 4   GSSGFLTEFINYIKKSKVVLLEDLAFQMGLRTQDAINRIQDLLTEGTLTGVIDDRGKFIY 63
Query: 191 ISQA 194
           I+ +
Sbjct: 64  ITPS 67

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query243
1wi9_A72 Protein C20ORF116 homolog; helix-turn-helix motif, 6e-28
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
>1wi9_A Protein C20ORF116 homolog; helix-turn-helix motif, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: a.4.5.47 Length = 72 Back     alignment and structure
 Score =  100 bits (251), Expect = 6e-28
 Identities = 34/65 (52%), Positives = 44/65 (67%)

Query: 130 DGDRDLLADFVEYIKKHKCIPLEDLAAEFKLRTQECINRITSLENMGRLSGVMDDRGKYI 189
            G    L +F+ YIKK K + LEDLA +  LRTQ+ INRI  L   G L+GV+DDRGK+I
Sbjct: 3   SGSSGFLTEFINYIKKSKVVLLEDLAFQMGLRTQDAINRIQDLLTEGTLTGVIDDRGKFI 62

Query: 190 YISQA 194
           YI+ +
Sbjct: 63  YITPS 67
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query243
1wi9_A72 Protein C20ORF116 homolog; helix-turn-helix motif, 100.0
3cuo_A99 Uncharacterized HTH-type transcriptional regulato; 97.32
1ub9_A100 Hypothetical protein PH1061; helix-turn-helix moti 97.22
2oqg_A114 Possible transcriptional regulator, ARSR family P; 96.67
1tbx_A99 ORF F-93, hypothetical 11.0 kDa protein; sulfolobu 96.66
1xn7_A78 Hypothetical protein YHGG; alpha+beta, GFT structu 96.61
3jth_A98 Transcription activator HLYU; transcription factor 96.61
3tgn_A146 ADC operon repressor ADCR; helix-turn-helix, trans 96.55
2k02_A87 Ferrous iron transport protein C; FEOC, iron-sulfu 96.51
2htj_A81 P fimbrial regulatory protein KS71A; winged helix- 96.51
3f6o_A118 Probable transcriptional regulator, ARSR family pr 96.47
1u2w_A122 CADC repressor, cadmium efflux system accessory pr 96.46
2cg4_A152 Regulatory protein ASNC; DNA binding, FFRP, LRP fa 96.46
1r1u_A106 CZRA, repressor protein; zinc, DNA binding, transc 96.45
2pn6_A150 ST1022, 150AA long hypothetical transcriptional re 96.42
2kko_A108 Possible transcriptional regulatory protein (possi 96.35
3oop_A143 LIN2960 protein; protein structure initiative, PSI 96.31
2dbb_A151 Putative HTH-type transcriptional regulator PH006; 96.3
2hr3_A147 Probable transcriptional regulator; MCSG, structur 96.27
1sfx_A109 Conserved hypothetical protein AF2008; structural 96.26
1lj9_A144 Transcriptional regulator SLYA; HTH DNA binding pr 96.24
2jt1_A77 PEFI protein; solution structure, winged helix-tur 96.19
3pqk_A102 Biofilm growth-associated repressor; helix-turn-he 96.17
2heo_A67 Z-DNA binding protein 1; protein DLM1-Z-DNA comple 96.11
1on2_A142 Transcriptional regulator MNTR; helix-turn-helix, 96.06
3s2w_A159 Transcriptional regulator, MARR family; structural 96.03
2qvo_A95 Uncharacterized protein AF_1382; PSI, structural g 96.0
1i1g_A141 Transcriptional regulator LRPA; helix-turn-helix, 95.99
3f6v_A151 Possible transcriptional regulator, ARSR family pr 95.98
3bja_A139 Transcriptional regulator, MARR family, putative; 95.97
2p5v_A162 Transcriptional regulator, LRP/ASNC family; NMB057 95.94
3eco_A139 MEPR; mutlidrug efflux pump regulator winged helix 95.93
2nnn_A140 Probable transcriptional regulator; structural gen 95.92
2w25_A150 Probable transcriptional regulatory protein; trans 95.89
3cjn_A162 Transcriptional regulator, MARR family; silicibact 95.88
2eth_A154 Transcriptional regulator, putative, MAR family; M 95.87
2rdp_A150 Putative transcriptional regulator MARR; PFAM PF01 95.86
3bj6_A152 Transcriptional regulator, MARR family; helix-turn 95.84
3bro_A141 Transcriptional regulator; helix_TURN_helix, multi 95.84
3k0l_A162 Repressor protein; helix-turn-helix, structural ge 95.82
2fbi_A142 Probable transcriptional regulator; MARR, APC5816, 95.82
2a61_A145 Transcriptional regulator TM0710; APC4350, MCSG, m 95.8
3bdd_A142 Regulatory protein MARR; putative multiple antibio 95.8
2bv6_A142 MGRA, HTH-type transcriptional regulator MGRA; mul 95.77
3nrv_A148 Putative transcriptional regulator (MARR/EMRR FAM; 95.75
2gxg_A146 146AA long hypothetical transcriptional regulator; 95.73
2h09_A155 Transcriptional regulator MNTR; transcription regu 95.72
2e1c_A171 Putative HTH-type transcriptional regulator PH151; 95.71
3g3z_A145 NMB1585, transcriptional regulator, MARR family; t 95.7
2cyy_A151 Putative HTH-type transcriptional regulator PH151; 95.67
2frh_A127 SARA, staphylococcal accessory regulator A; winged 95.67
2fbh_A146 Transcriptional regulator PA3341; MARR, transcript 95.62
1jgs_A138 Multiple antibiotic resistance protein MARR; trans 95.61
3i4p_A162 Transcriptional regulator, ASNC family; PSI, struc 95.61
1s3j_A155 YUSO protein; structural genomics, MARR transcript 95.6
4hbl_A149 Transcriptional regulator, MARR family; HTH, trans 95.6
2fa5_A162 Transcriptional regulator MARR/EMRR family; multip 95.59
1ufm_A84 COP9 complex subunit 4; helix-turn-helix, structur 95.58
2cfx_A144 HTH-type transcriptional regulator LRPC; transcrip 95.56
3e6m_A161 MARR family transcriptional regulator; APC88769, s 95.55
3b73_A111 PHIH1 repressor-like protein; winged-helix-turn-he 95.55
3ech_A142 MEXR, multidrug resistance operon repressor; winge 95.54
3kp7_A151 Transcriptional regulator TCAR; multiple drug resi 95.52
3hsr_A140 HTH-type transcriptional regulator SARZ; helix-tur 95.5
3bpv_A138 Transcriptional regulator; MARR, DNA binding, tran 95.43
2pex_A153 Transcriptional regulator OHRR; transcription regu 95.42
2nyx_A168 Probable transcriptional regulatory protein, RV14; 95.4
3cdh_A155 Transcriptional regulator, MARR family; helix-turn 95.39
3f3x_A144 Transcriptional regulator, MARR family, putative; 95.39
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 95.37
2qww_A154 Transcriptional regulator, MARR family; YP_013417. 95.35
3jw4_A148 Transcriptional regulator, MARR/EMRR family; DNA-b 95.33
1q1h_A110 TFE, transcription factor E, TFE; TFIIE, transcrip 95.31
2pjp_A121 Selenocysteine-specific elongation factor; SELB, p 95.29
1z91_A147 Organic hydroperoxide resistance transcriptional; 95.28
2jsc_A118 Transcriptional regulator RV1994C/MT2050; cadmium, 95.25
2pg4_A95 Uncharacterized protein; structural genomics, join 95.23
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 95.22
3df8_A111 Possible HXLR family transcriptional factor; APC89 95.19
2lkp_A119 Transcriptional regulator, ARSR family; symmetric 95.17
1r1t_A122 Transcriptional repressor SMTB; zinc, transcriptio 95.16
2hzt_A107 Putative HTH-type transcriptional regulator YTCD; 95.16
3deu_A166 Transcriptional regulator SLYA; MARR, WING-helix, 95.14
3boq_A160 Transcriptional regulator, MARR family; MARR famil 95.05
2ia0_A171 Putative HTH-type transcriptional regulator PF086; 95.04
3nqo_A189 MARR-family transcriptional regulator; structural 94.92
1qgp_A77 Protein (double stranded RNA adenosine deaminase); 94.91
3fm5_A150 Transcriptional regulator; MCSG, PF04017, PSI, MAR 94.9
2xvc_A59 ESCRT-III, SSO0910; cell cycle, cell division, cyt 94.79
2d1h_A109 ST1889, 109AA long hypothetical transcriptional re 94.77
2fxa_A207 Protease production regulatory protein HPR; protea 94.45
2x4h_A139 Hypothetical protein SSO2273; transcription; 2.30A 94.34
2fsw_A107 PG_0823 protein; alpha-beta structure, helix-turn- 94.34
1qbj_A81 Protein (double-stranded RNA specific adenosine D 94.24
3u2r_A168 Regulatory protein MARR; structural genomics, PSI- 94.2
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 94.1
1j5y_A187 Transcriptional regulator, biotin repressor famil; 93.99
2zkz_A99 Transcriptional repressor PAGR; protein-DNA, HTH m 93.83
1yyv_A131 Putative transcriptional regulator; reductive meth 93.75
2f2e_A146 PA1607; transcription factor, helix-TRUN-helix, AP 93.68
1lva_A258 Selenocysteine-specific elongation factor; winged- 93.65
1z7u_A112 Hypothetical protein EF0647; winged-helix-turn-hel 93.2
4aik_A151 Transcriptional regulator SLYA; transcription, tra 93.14
1oyi_A82 Double-stranded RNA-binding protein; (alpha+beta) 93.1
4b8x_A147 SCO5413, possible MARR-transcriptional regulator; 93.05
2v79_A135 DNA replication protein DNAD; primosome, DNA-bindi 92.94
1xmk_A79 Double-stranded RNA-specific adenosine deaminase; 92.94
2b0l_A102 GTP-sensing transcriptional pleiotropic repressor; 92.69
2fbk_A181 Transcriptional regulator, MARR family; winged-hel 92.58
3r0a_A123 Putative transcriptional regulator; structural gen 92.42
1y0u_A96 Arsenical resistance operon repressor, putative; s 91.89
3tqn_A113 Transcriptional regulator, GNTR family; regulatory 91.83
1ku9_A152 Hypothetical protein MJ223; putative transcription 91.77
3lmm_A583 Uncharacterized protein; multi-domained alpha-beta 91.48
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 91.2
2dk8_A81 DNA-directed RNA polymerase III 39 kDa polypeptide 91.02
2wte_A244 CSA3; antiviral protein, viral resistance, winged 90.99
3hrs_A 214 Metalloregulator SCAR; DTXR/MNTR family member, tr 90.97
1bia_A 321 BIRA bifunctional protein; transcription regulatio 90.33
1p4x_A250 Staphylococcal accessory regulator A homologue; wi 90.28
1uly_A192 Hypothetical protein PH1932; helix-turn-helix, str 90.0
3mn2_A108 Probable ARAC family transcriptional regulator; st 89.86
2fu4_A83 Ferric uptake regulation protein; DNA binding doma 89.76
1okr_A123 MECI, methicillin resistance regulatory protein ME 89.35
3oou_A108 LIN2118 protein; protein structure initiative, PSI 89.3
2p5k_A64 Arginine repressor; DNA-binding domain, winged hel 89.29
3u5c_Z108 RP45, S31, YS23, 40S ribosomal protein S25-A; tran 89.26
2xzm_8143 RPS25E,; ribosome, translation; 3.93A {Tetrahymena 88.78
3iz6_V108 40S ribosomal protein S25 (S25E); eukaryotic ribos 88.76
3neu_A125 LIN1836 protein; structural genomics, PSI-2, prote 88.74
1sfu_A75 34L protein; protein/Z-DNA complex, DNA binding pr 88.59
4ev0_A216 Transcription regulator, CRP family; CAMP binding, 88.53
4a5n_A131 Uncharacterized HTH-type transcriptional regulato; 88.46
4b4t_O393 26S proteasome regulatory subunit RPN9; hydrolase, 88.27
3k2z_A196 LEXA repressor; winged helix-turn-helix, SOS syste 88.06
3oio_A113 Transcriptional regulator (ARAC-type DNA-binding c 87.9
2k9s_A107 Arabinose operon regulatory protein; activator, ar 87.88
1b4a_A149 Arginine repressor; helix turn helix; 2.50A {Geoba 87.4
3iuo_A122 ATP-dependent DNA helicase RECQ; C-terminal, GI PS 87.32
2g9w_A138 Conserved hypothetical protein; DNA-binding domain 87.16
1hsj_A487 Fusion protein consisting of staphylococcus access 87.15
3tdu_C77 Cullin-1, CUL-1; E2:E3, ligase-protein binding com 87.1
4fx0_A148 Probable transcriptional repressor protein; helix- 86.31
3lsg_A103 Two-component response regulator YESN; structural 85.94
1mkm_A 249 ICLR transcriptional regulator; structural genomic 85.84
1p6r_A82 Penicillinase repressor; transcription regulation, 85.83
3by6_A126 Predicted transcriptional regulator; structural ge 85.79
3cuq_B218 Vacuolar protein-sorting-associated protein 36; ES 85.76
3o2p_E88 Cell division control protein 53; ligase, cell cyc 85.36
3mkl_A120 HTH-type transcriptional regulator GADX; PSI2, MCS 84.84
2qq9_A 226 Diphtheria toxin repressor; regulator, DTXR, helix 84.79
1pdn_C128 Protein (PRD paired); protein-DNA complex, double 84.69
2ba3_A51 NIKA; dimer, bacterial conjugation, relaxase, DNA 84.68
1bl0_A129 Protein (multiple antibiotic resistance protein), 84.54
2do7_A101 Cullin-4B, CUL-4B; helix-turn-helix motif, structu 84.29
3chm_A169 COP9 signalosome complex subunit 7; heat/ARM repea 84.01
3dv8_A220 Transcriptional regulator, CRP/FNR family; cyclic 83.88
1iuy_A92 Cullin-3 homologue; winged helix, structural genom 83.74
2co5_A99 Viral protein F93; viral protein-winged helix comp 83.23
3cta_A 230 Riboflavin kinase; structural genomics, transferas 82.77
1p4x_A 250 Staphylococcal accessory regulator A homologue; wi 82.63
1fx7_A 230 Iron-dependent repressor IDER; DTXR, iron-dependen 82.09
3l7w_A108 Putative uncharacterized protein SMU.1704; PADR, t 81.62
2ek5_A129 Predicted transcriptional regulators; helix-turn-h 81.53
1ft9_A222 Carbon monoxide oxidation system transcription reg 81.09
2vn2_A128 DNAD, chromosome replication initiation protein; D 80.97
2y75_A129 HTH-type transcriptional regulator CYMR; DNA bindi 80.96
1sd4_A126 Penicillinase repressor; BLAI, MECI, methicillin, 80.91
2qc0_A373 Uncharacterized protein; NP_719793.1, uncharacteri 80.86
3d0s_A227 Transcriptional regulatory protein; CAMP receptor 80.4
3fx3_A237 Cyclic nucleotide-binding protein; helix_TURN_heli 80.3
1k78_A149 Paired box protein PAX5; paired domain, ETS domain 80.19
>1wi9_A Protein C20ORF116 homolog; helix-turn-helix motif, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: a.4.5.47 Back     alignment and structure
Probab=100.00  E-value=2.5e-35  Score=220.85  Aligned_cols=69  Identities=49%  Similarity=0.830  Sum_probs=66.3

Q ss_pred             ccchhHHHHHHHHHHhcCccchHHHHHHcCCChHHHHHHHHHHHhcCCcceeeeCCCCeEEEcHHHHHH
Q 026130          130 DGDRDLLADFVEYIKKHKCIPLEDLAAEFKLRTQECINRITSLENMGRLSGVMDDRGKYIYISQAEMKA  198 (243)
Q Consensus       130 ~~~~~lL~~Fi~yIK~~KvV~LEdLA~~F~lrtqd~I~RIq~Le~~g~LtGViDDRGKFIYIS~eEl~a  198 (243)
                      ++++++|++||+|||.+|||+|+|||++|||+|++||+||++|+++|+|||||||||||||||++||++
T Consensus         3 ~~~~~ll~~Fi~yIk~~Kvv~LedLA~~F~l~t~~~i~RI~~Le~~g~ltGViDDRGKfIyIs~eE~~a   71 (72)
T 1wi9_A            3 SGSSGFLTEFINYIKKSKVVLLEDLAFQMGLRTQDAINRIQDLLTEGTLTGVIDDRGKFIYITPSGPSS   71 (72)
T ss_dssp             CSSCCHHHHHHHHHHHCSEECHHHHHHHHCSCHHHHHHHHHHHHHHSSSCEEECTTCCEEECCCSSCCC
T ss_pred             hhHHHHHHHHHHHHHHcCeeeHHHHHHHhCCChHHHHHHHHHHHHCCCeEEEEeCCCCEEEecHHHhhc
Confidence            357899999999999999999999999999999999999999999999999999999999999999864
>3cuo_A Uncharacterized HTH-type transcriptional regulato; DNA-binding transcriptional regulator, structural genomics, MCSG; 2.00A {Escherichia coli K12} Back     alignment and structure
>1ub9_A Hypothetical protein PH1061; helix-turn-helix motif, winged helix motif, structural genom transcription; 2.05A {Pyrococcus horikoshii} SCOP: a.4.5.28 Back     alignment and structure
>2oqg_A Possible transcriptional regulator, ARSR family P; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 1.54A {Rhodococcus SP} Back     alignment and structure
>1tbx_A ORF F-93, hypothetical 11.0 kDa protein; sulfolobus spindle virus, winged helix, fusellovirus; 2.70A {Sulfolobus virus 1} SCOP: a.4.5.48 Back     alignment and structure
>1xn7_A Hypothetical protein YHGG; alpha+beta, GFT structural genomics, protein structure initiative, PSI, NESG; NMR {Escherichia coli} SCOP: a.4.5.62 Back     alignment and structure
>3jth_A Transcription activator HLYU; transcription factor, RTXA, DNA-binding, transcription regulation; 2.00A {Vibrio vulnificus} Back     alignment and structure
>3tgn_A ADC operon repressor ADCR; helix-turn-helix, transcriptional regulator, transcription; 2.00A {Streptococcus pneumoniae} Back     alignment and structure
>2k02_A Ferrous iron transport protein C; FEOC, iron-sulfur, metal-binding, metal binding protein; NMR {Klebsiella pneumoniae subsp} Back     alignment and structure
>2htj_A P fimbrial regulatory protein KS71A; winged helix-turn-helix, PAP PILI, transcription activator; NMR {Escherichia coli} SCOP: a.4.5.73 Back     alignment and structure
>3f6o_A Probable transcriptional regulator, ARSR family protein; transcriptional regulator,RHA00566,MCSG, structural genomics, PSI-2; 1.90A {Rhodococcus SP} Back     alignment and structure
>1u2w_A CADC repressor, cadmium efflux system accessory protein; LEAD, SOFT metal ION resistance, ARSR/SM family, DNA binding protein; 1.90A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 3f72_A Back     alignment and structure
>2cg4_A Regulatory protein ASNC; DNA binding, FFRP, LRP family, transcription, DNA- binding, transcription regulation; 2.4A {Escherichia coli} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>1r1u_A CZRA, repressor protein; zinc, DNA binding, transcriptional regulation, winged HTH protein, transcription repressor; 2.00A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 1r1v_A 2kjb_A 2kjc_A Back     alignment and structure
>2pn6_A ST1022, 150AA long hypothetical transcriptional regulator; LRP/ASNC family Gln binding, structural genomics, NPPSFA; HET: GLN; 1.44A {Sulfolobus tokodaii} PDB: 2efn_A* 2e7x_A* 2e7w_A* 2yx4_A* 2efq_A* 2pmh_A* 2yx7_A* 2efp_A* 2efo_A* Back     alignment and structure
>2kko_A Possible transcriptional regulatory protein (possibly ARSR-family); NESG, DNA-binding, transcription regulation, WHTH, homodimer; NMR {Mycobacterium bovis} PDB: 3gw2_A Back     alignment and structure
>3oop_A LIN2960 protein; protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG, unknown function; 1.78A {Listeria innocua} Back     alignment and structure
>2dbb_A Putative HTH-type transcriptional regulator PH006; ASNC family, helix-turn-helix (HTH) domain, structural genom NPPSFA; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2hr3_A Probable transcriptional regulator; MCSG, structural genomics, PSI-2, protein structure initiati midwest center for structural genomics; 2.40A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>1sfx_A Conserved hypothetical protein AF2008; structural genomics, HTH MOT protein structure initiative, midwest center for structural genomics; 1.55A {Archaeoglobus fulgidus} SCOP: a.4.5.50 Back     alignment and structure
>1lj9_A Transcriptional regulator SLYA; HTH DNA binding protein, structural genomics, PSI, protein structure initiative; 1.60A {Enterococcus faecalis} SCOP: a.4.5.28 Back     alignment and structure
>2jt1_A PEFI protein; solution structure, winged helix-turn-helix, transcripti regulatory protein, structural genomics, PSI-2; NMR {Salmonella typhimurium LT2} Back     alignment and structure
>3pqk_A Biofilm growth-associated repressor; helix-turn-helix motif, winged-helix fold, transcriptional R DNA binding, transcription; 2.09A {Xylella fastidiosa} PDB: 3pqj_A Back     alignment and structure
>2heo_A Z-DNA binding protein 1; protein DLM1-Z-DNA complex, immune system-DNA complex; 1.70A {Mus musculus} PDB: 1j75_A Back     alignment and structure
>1on2_A Transcriptional regulator MNTR; helix-turn-helix, DNA-binding protein, metalloregulatory protein; 1.61A {Bacillus subtilis} SCOP: a.4.5.24 a.76.1.1 PDB: 2ev0_A 1on1_A 2ev5_A 2ev6_A* 2f5c_A 2f5d_A 2f5e_A 2f5f_A 2hyf_A* 2hyg_D 3r60_A* 3r61_A* Back     alignment and structure
>3s2w_A Transcriptional regulator, MARR family; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 2.45A {Methanosarcina mazei} Back     alignment and structure
>2qvo_A Uncharacterized protein AF_1382; PSI, structural genomics, southeast collaboratory for structural genomics; 1.85A {Archaeoglobus fulgidus dsm 4304} PDB: 3o3k_A 3ov8_A Back     alignment and structure
>1i1g_A Transcriptional regulator LRPA; helix-turn-helix, LRP/ASNC family; 2.90A {Pyrococcus furiosus} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>3f6v_A Possible transcriptional regulator, ARSR family protein; probable transcriptional repressor ARSR family, structural genomics, PSI-2; 1.48A {Rhodococcus SP} Back     alignment and structure
>3bja_A Transcriptional regulator, MARR family, putative; NP_978771.1, putative MARR-like transcription regulator, MAR structural genomics; 2.38A {Bacillus cereus} Back     alignment and structure
>2p5v_A Transcriptional regulator, LRP/ASNC family; NMB0573, structu genomics; 1.99A {Neisseria meningitidis} PDB: 2p6s_A 2p6t_A Back     alignment and structure
>3eco_A MEPR; mutlidrug efflux pump regulator winged helix-turn-helix motif, DNA-binding, transcription, transcription regulation; 2.40A {Staphylococcus aureus} SCOP: a.4.5.0 Back     alignment and structure
>2nnn_A Probable transcriptional regulator; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>2w25_A Probable transcriptional regulatory protein; transcription regulation, mutant, RV3291C, Glu104Ala, DNA-binding; 2.15A {Mycobacterium tuberculosis} PDB: 2vbw_A* 2vbx_A* 2vby_A* 2vbz_A* 2vc0_A 2vc1_A 2w24_A 2ivm_A 2w29_A 2qz8_A Back     alignment and structure
>3cjn_A Transcriptional regulator, MARR family; silicibacter pomeroy structural genomics, PSI-2, protein structure initiative; 1.95A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2eth_A Transcriptional regulator, putative, MAR family; MARR family, structural genomics, joint center for structura genomics, JCSG; 2.30A {Thermotoga maritima} SCOP: a.4.5.28 Back     alignment and structure
>2rdp_A Putative transcriptional regulator MARR; PFAM PF01047, winged-helix binding motif, structural genomics, PSI-2; 2.30A {Geobacillus stearothermophilus} Back     alignment and structure
>3bj6_A Transcriptional regulator, MARR family; helix-turn-helix, trasnscription regulator, STR genomics, PSI-2, protein structure initiative; 2.01A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3bro_A Transcriptional regulator; helix_TURN_helix, multiple antibiotic resistance protein (MA structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.04A {Oenococcus oeni} SCOP: a.4.5.28 Back     alignment and structure
>3k0l_A Repressor protein; helix-turn-helix, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.35A {Acinetobacter SP} Back     alignment and structure
>2fbi_A Probable transcriptional regulator; MARR, APC5816, structural genomic protein structure initiative; 2.10A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>2a61_A Transcriptional regulator TM0710; APC4350, MCSG, midwest center for structural genomics, PSI, protein structure initiative, MARR; 1.80A {Thermotoga maritima} SCOP: a.4.5.28 Back     alignment and structure
>3bdd_A Regulatory protein MARR; putative multiple antibiotic-resistance repressor, structura genomics, joint center for structural genomics, JCSG; 2.20A {Streptococcus suis} Back     alignment and structure
>2bv6_A MGRA, HTH-type transcriptional regulator MGRA; multidrug resistance regulator, virulence determinant, transcriptional factors; 2.8A {Staphylococcus aureus} SCOP: a.4.5.28 Back     alignment and structure
>3nrv_A Putative transcriptional regulator (MARR/EMRR FAM; PSI-2, protein structure initiati structural genomics; HET: MSE; 2.00A {Acinetobacter SP} Back     alignment and structure
>2gxg_A 146AA long hypothetical transcriptional regulator; winged helix; 1.45A {Sulfolobus tokodaii} PDB: 2eb7_A 2yr2_A 3gez_A 3gf2_A* 3gfi_A 3gfm_A 3gfj_A 3gfl_A Back     alignment and structure
>2h09_A Transcriptional regulator MNTR; transcription regulator, diphtheria toxin, manganese transport, structural genomics, NPPSFA; 2.10A {Escherichia coli} Back     alignment and structure
>3g3z_A NMB1585, transcriptional regulator, MARR family; transcription factor, structur genomics, oxford protein production facility; 2.10A {Neisseria meningitidis serogroup B} Back     alignment and structure
>2cyy_A Putative HTH-type transcriptional regulator PH151; structural genomics, pyrococcus horikosii OT3, NPPSFA; HET: MSE GLN; 1.80A {Pyrococcus horikoshii} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>2frh_A SARA, staphylococcal accessory regulator A; winged-helix protein, divalent metal binding, transcription; 2.50A {Staphylococcus aureus} SCOP: a.4.5.28 PDB: 2fnp_A 1fzp_D Back     alignment and structure
>2fbh_A Transcriptional regulator PA3341; MARR, transcription regulator, APC5857, structural genomics, protein structure initiative; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>1jgs_A Multiple antibiotic resistance protein MARR; transcription regulation, DNA-binding, repressor, transcription; HET: SAL; 2.30A {Escherichia coli} SCOP: a.4.5.28 Back     alignment and structure
>3i4p_A Transcriptional regulator, ASNC family; PSI, structural genom protein structure initiative, midwest center for structural genomics; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>1s3j_A YUSO protein; structural genomics, MARR transcriptional regulator family, PSI, protein structure initiative; HET: MSE; 2.25A {Bacillus subtilis} SCOP: a.4.5.28 Back     alignment and structure
>4hbl_A Transcriptional regulator, MARR family; HTH, transcription factor, DNA binding; 2.50A {Staphylococcus epidermidis} Back     alignment and structure
>2fa5_A Transcriptional regulator MARR/EMRR family; multiple antibiotics resistance repressor, XCC structural genomics, X-RAY diffraction; 1.80A {Xanthomonas campestris} Back     alignment and structure
>1ufm_A COP9 complex subunit 4; helix-turn-helix, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: a.4.5.47 Back     alignment and structure
>2cfx_A HTH-type transcriptional regulator LRPC; transcriptional regulation, DNA binding, FFRP; 2.4A {Bacillus subtilis} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>3e6m_A MARR family transcriptional regulator; APC88769, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; 2.20A {Silicibacter pomeroyi} Back     alignment and structure
>3b73_A PHIH1 repressor-like protein; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 2.12A {Haloarcula marismortui atcc 43049} Back     alignment and structure
>3ech_A MEXR, multidrug resistance operon repressor; winged helix, helix-turn-helix, protein-peptide complex; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 PDB: 1lnw_A 3mex_A Back     alignment and structure
>3kp7_A Transcriptional regulator TCAR; multiple drug resistance, biofilm, transcription regulation, binding, transcription regulator; 2.30A {Staphylococcus epidermidis RP62A} PDB: 3kp3_A* 3kp4_A* 3kp5_A* 3kp2_A* 3kp6_A Back     alignment and structure
>3hsr_A HTH-type transcriptional regulator SARZ; helix-turn-helix, cysteine disulfide, MARR-family transcript regulator, DNA-binding; 1.90A {Staphylococcus aureus subsp} PDB: 3hse_A 3hrm_A 4gxo_A Back     alignment and structure
>3bpv_A Transcriptional regulator; MARR, DNA binding, transcription factor, winged helix motif, DNA-binding; 1.40A {Methanobacterium thermoautotrophicum} PDB: 3bpx_A* Back     alignment and structure
>2pex_A Transcriptional regulator OHRR; transcription regulator; 1.90A {Xanthomonas campestris} PDB: 2pfb_A Back     alignment and structure
>2nyx_A Probable transcriptional regulatory protein, RV14; alpha/beta, structural genomics, PSI-2; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>3cdh_A Transcriptional regulator, MARR family; helix-turn-hleix, structura genomics, PSI-2, protein structure initiative; 2.69A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3f3x_A Transcriptional regulator, MARR family, putative; DNA binding protein, DNA-binding, transcription regulation; 1.90A {Sulfolobus solfataricus} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qww_A Transcriptional regulator, MARR family; YP_013417.1, multiple antibiotic-resistance repressor (MARR) structural genomics; HET: MSE; 2.07A {Listeria monocytogenes str} Back     alignment and structure
>3jw4_A Transcriptional regulator, MARR/EMRR family; DNA-binding protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.10A {Clostridium acetobutylicum} SCOP: a.4.5.0 Back     alignment and structure
>1q1h_A TFE, transcription factor E, TFE; TFIIE, transcription initiation, preinitiation complex, RNA polymerase II, transcription bubble; 2.90A {Sulfolobus solfataricus} SCOP: a.4.5.41 Back     alignment and structure
>2pjp_A Selenocysteine-specific elongation factor; SELB, protein-RNA complex, elongation factor, winged- helix, bulge, translation/RNA complex; 2.30A {Escherichia coli} Back     alignment and structure
>1z91_A Organic hydroperoxide resistance transcriptional; OHRR, MARR family, bacterial transcription factor, DNA bindi protein; 2.50A {Bacillus subtilis} SCOP: a.4.5.28 PDB: 1z9c_A* Back     alignment and structure
>2pg4_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, DNA binding protein; HET: MSE CIT; 2.21A {Aeropyrum pernix} SCOP: a.4.5.48 Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3df8_A Possible HXLR family transcriptional factor; APC89000, structural genomics, midwest center for structural genomics, MCSG; 1.65A {Thermoplasma volcanium} SCOP: a.4.5.0 Back     alignment and structure
>2lkp_A Transcriptional regulator, ARSR family; symmetric homodimer, NI(II) binding protein, DNA binding Pro transcription regulator; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>1r1t_A Transcriptional repressor SMTB; zinc, transcriptional regulation, winged HTH protein, DNA binding, transcription repressor; 1.70A {Synechococcus elongatus pcc 7942} SCOP: a.4.5.5 PDB: 1r23_A 1smt_A 1r22_A Back     alignment and structure
>2hzt_A Putative HTH-type transcriptional regulator YTCD; DNA-binding protein, HTH-type transcription regulators, structural genomics, PSI-2; HET: CSU MSE; 2.00A {Bacillus subtilis} SCOP: a.4.5.69 Back     alignment and structure
>3deu_A Transcriptional regulator SLYA; MARR, WING-helix, transcription regulator, activator, DNA-binding, repressor; HET: SAL; 2.30A {Salmonella typhimurium} SCOP: a.4.5.28 Back     alignment and structure
>3boq_A Transcriptional regulator, MARR family; MARR famil structural genomics, PSI-2, protein structure initiative; 2.39A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2ia0_A Putative HTH-type transcriptional regulator PF086; ASNC, PSI, structural genomics, southeast collaboratory for structural genomics; 2.37A {Pyrococcus furiosus} Back     alignment and structure
>3nqo_A MARR-family transcriptional regulator; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE PG4; 2.20A {Clostridium difficile} Back     alignment and structure
>1qgp_A Protein (double stranded RNA adenosine deaminase); Z-alpha-Z-DNA binding domain, RNA-editing, Z-DNA recognition, ADAR1, helix- turn-helix; NMR {Homo sapiens} SCOP: a.4.5.19 Back     alignment and structure
>3fm5_A Transcriptional regulator; MCSG, PF04017, PSI, MARR, structu genomics, protein structure initiative, midwest center for structural genomics; HET: GOL; 2.00A {Rhodococcus jostii} Back     alignment and structure
>2xvc_A ESCRT-III, SSO0910; cell cycle, cell division, cytokinesis, winged-helix; 2.15A {Sulfolobus solfataricus} Back     alignment and structure
>2d1h_A ST1889, 109AA long hypothetical transcriptional regulator; helix-turn-helix, intermolecular and intramolecular S-S bond structural genomics; 2.05A {Sulfolobus tokodaii} SCOP: a.4.5.50 Back     alignment and structure
>2fxa_A Protease production regulatory protein HPR; protease porduction, regulation, STR genomics, PSI, protein structure initiative; HET: PGE P6G 1PE; 2.40A {Bacillus subtilis} SCOP: a.4.5.28 Back     alignment and structure
>2x4h_A Hypothetical protein SSO2273; transcription; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2fsw_A PG_0823 protein; alpha-beta structure, helix-turn-helix, winged-helix-turn-HE structural genomics, PSI, protein structure initiative; HET: MSE; 2.16A {Porphyromonas gingivalis} SCOP: a.4.5.69 Back     alignment and structure
>1qbj_A Protein (double-stranded RNA specific adenosine D (ADAR1)); protein-Z-DNA complex, hydrolase-DNA complex; HET: DNA; 2.10A {Homo sapiens} SCOP: a.4.5.19 PDB: 3f21_A* 3f22_A* 3f23_A* 3irr_A* 3irq_D* 2gxb_A 2acj_A 2l54_A Back     alignment and structure
>3u2r_A Regulatory protein MARR; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, helix-turn-helix; 2.20A {Planctomyces limnophilus} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1j5y_A Transcriptional regulator, biotin repressor famil; structural genomics, TM1602, BIOT repressor family, JCSG, conserved hypothetical protein; 2.30A {Thermotoga maritima} SCOP: a.4.5.1 d.94.2.1 Back     alignment and structure
>2zkz_A Transcriptional repressor PAGR; protein-DNA, HTH motif, dimer, DN binding, transcription regulation; 2.00A {Bacillus anthracis} Back     alignment and structure
>1yyv_A Putative transcriptional regulator; reductive methylation, D lysine, structural genomics, PSI; HET: MLY; 2.35A {Salmonella typhimurium} SCOP: a.4.5.69 Back     alignment and structure
>2f2e_A PA1607; transcription factor, helix-TRUN-helix, APC5613, structural genomics, PSI, protein structure initiative; HET: GLC; 1.85A {Pseudomonas aeruginosa} SCOP: a.4.5.69 Back     alignment and structure
>1lva_A Selenocysteine-specific elongation factor; winged-helix, translation; 2.12A {Moorella thermoacetica} SCOP: a.4.5.35 a.4.5.35 a.4.5.35 a.4.5.35 PDB: 2uwm_A 2ply_A 1wsu_A Back     alignment and structure
>1z7u_A Hypothetical protein EF0647; winged-helix-turn-helix, MARR, structural genomics, PSI, Pro structure initiative; 2.20A {Enterococcus faecalis} SCOP: a.4.5.69 Back     alignment and structure
>4aik_A Transcriptional regulator SLYA; transcription, transcription factor; 1.85A {Yersinia pseudotuberculosis} PDB: 4aih_A 4aij_A 3qpt_A* 3q5f_A* Back     alignment and structure
>1oyi_A Double-stranded RNA-binding protein; (alpha+beta) helix-turn-helix, viral protein; NMR {Vaccinia virus} SCOP: a.4.5.19 Back     alignment and structure
>4b8x_A SCO5413, possible MARR-transcriptional regulator; winged helix motif; HET: CME; 1.25A {Streptomyces coelicolor} Back     alignment and structure
>2v79_A DNA replication protein DNAD; primosome, DNA-binding protein; HET: DNA; 2.00A {Bacillus subtilis} Back     alignment and structure
>1xmk_A Double-stranded RNA-specific adenosine deaminase; winged helix-turn-helix, RNA editing, interferon, ADAR1, hydrolase; 0.97A {Homo sapiens} SCOP: a.4.5.19 Back     alignment and structure
>2b0l_A GTP-sensing transcriptional pleiotropic repressor; CODY, DNA-binding, nucleotide-binding, transcript regulation, winged HTH motif.; 2.90A {Bacillus subtilis} SCOP: a.4.5.66 Back     alignment and structure
>2fbk_A Transcriptional regulator, MARR family; winged-helix-turn-helix; 2.30A {Deinococcus radiodurans} SCOP: a.4.5.28 Back     alignment and structure
>3r0a_A Putative transcriptional regulator; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.31A {Methanosarcina mazei} Back     alignment and structure
>1y0u_A Arsenical resistance operon repressor, putative; structural genomics, protein structure initiative, PSI; HET: MSE; 1.60A {Archaeoglobus fulgidus} SCOP: a.4.5.5 Back     alignment and structure
>3tqn_A Transcriptional regulator, GNTR family; regulatory functions; 2.80A {Coxiella burnetii} Back     alignment and structure
>1ku9_A Hypothetical protein MJ223; putative transcription factor, homodimeric winged-helix fold, structural genomics, PSI; 2.80A {Methanocaldococcus jannaschii} SCOP: a.4.5.36 Back     alignment and structure
>3lmm_A Uncharacterized protein; multi-domained alpha-beta protein, structural genomics, PSI- 2, protein structure initiative; 3.00A {Corynebacterium diphtheriae} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2dk8_A DNA-directed RNA polymerase III 39 kDa polypeptide; structural genomics, RNA_POL_RPC34 domain, RNA polymerase III C39 subunit, NPPSFA; NMR {Mus musculus} SCOP: a.4.5.85 Back     alignment and structure
>2wte_A CSA3; antiviral protein, viral resistance, winged helix-turn-helix prnai nucleotide-binding domain; HET: MSE; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>3hrs_A Metalloregulator SCAR; DTXR/MNTR family member, transcription; 2.70A {Streptococcus gordonii} PDB: 3hrt_A 3hru_A Back     alignment and structure
>1bia_A BIRA bifunctional protein; transcription regulation; 2.30A {Escherichia coli} SCOP: a.4.5.1 b.34.1.1 d.104.1.2 PDB: 1bib_A* 1hxd_A* 2ewn_A* Back     alignment and structure
>1p4x_A Staphylococcal accessory regulator A homologue; winged-helix protein, transcription; 2.20A {Staphylococcus aureus} SCOP: a.4.5.28 a.4.5.28 Back     alignment and structure
>1uly_A Hypothetical protein PH1932; helix-turn-helix, structural genomics, DNA binding protein; 2.50A {Pyrococcus horikoshii} SCOP: a.4.5.58 PDB: 2cwe_A Back     alignment and structure
>3mn2_A Probable ARAC family transcriptional regulator; structural genomics, PSI-2, protein structure initiative; 1.80A {Rhodopseudomonas palustris} Back     alignment and structure
>2fu4_A Ferric uptake regulation protein; DNA binding domain, helix-turn-helix, DNA binding protein; 1.80A {Escherichia coli} Back     alignment and structure
>1okr_A MECI, methicillin resistance regulatory protein MECI; bacterial antibiotic resistance, MECI protein, transcriptional regulatory element; 2.4A {Staphylococcus aureus} SCOP: a.4.5.39 PDB: 1sax_A 1sd7_A 2d45_A 1sd6_A Back     alignment and structure
>3oou_A LIN2118 protein; protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG, unknown function; HET: BTB; 1.57A {Listeria innocua} Back     alignment and structure
>2p5k_A Arginine repressor; DNA-binding domain, winged helix-turn-helix (WHTH), DNA binding protein; 1.00A {Bacillus subtilis} SCOP: a.4.5.3 PDB: 2p5l_C* Back     alignment and structure
>3u5c_Z RP45, S31, YS23, 40S ribosomal protein S25-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_V 3o30_Q 3o2z_Q 3u5g_Z Back     alignment and structure
>2xzm_8 RPS25E,; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_8 Back     alignment and structure
>3iz6_V 40S ribosomal protein S25 (S25E); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3neu_A LIN1836 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, unknown function; 1.58A {Listeria innocua} Back     alignment and structure
>1sfu_A 34L protein; protein/Z-DNA complex, DNA binding protein/DNA complex; 2.00A {Yaba-like disease virus} SCOP: a.4.5.19 Back     alignment and structure
>4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Back     alignment and structure
>4a5n_A Uncharacterized HTH-type transcriptional regulato; activator, DNA binding, MARR-like; 1.81A {Bacillus subtilis} PDB: 4a5m_A Back     alignment and structure
>4b4t_O 26S proteasome regulatory subunit RPN9; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3k2z_A LEXA repressor; winged helix-turn-helix, SOS system, autoca cleavage, DNA damage, DNA repair, DNA replication, DNA-BIND hydrolase; 1.37A {Thermotoga maritima} Back     alignment and structure
>3oio_A Transcriptional regulator (ARAC-type DNA-binding containing proteins); PSI-2, midwest center for structural genomics; 1.65A {Chromobacterium violaceum} Back     alignment and structure
>2k9s_A Arabinose operon regulatory protein; activator, arabinose catabolism, carbohydrate metabolism, cytoplasm, DNA-binding, repressor, transcription; NMR {Escherichia coli} Back     alignment and structure
>1b4a_A Arginine repressor; helix turn helix; 2.50A {Geobacillus stearothermophilus} SCOP: a.4.5.3 d.74.2.1 PDB: 1f9n_A Back     alignment and structure
>3iuo_A ATP-dependent DNA helicase RECQ; C-terminal, GI PSI, MCSG, structural genomics, midwest center for structur genomics; 1.60A {Porphyromonas gingivalis} Back     alignment and structure
>2g9w_A Conserved hypothetical protein; DNA-binding domain, bacterial transcription repressor, DNA B protein; 1.80A {Mycobacterium tuberculosis} SCOP: a.4.5.39 Back     alignment and structure
>1hsj_A Fusion protein consisting of staphylococcus accessary regulator protein R and maltose...; novel fold for DNA binding; HET: GLC; 2.30A {Escherichia coli} SCOP: a.4.5.28 c.94.1.1 Back     alignment and structure
>3tdu_C Cullin-1, CUL-1; E2:E3, ligase-protein binding complex; 1.50A {Homo sapiens} PDB: 3tdz_C Back     alignment and structure
>4fx0_A Probable transcriptional repressor protein; helix-turn-helix, DNA binding, transcription regulator; 2.70A {Mycobacterium tuberculosis} PDB: 4fx4_A* Back     alignment and structure
>3lsg_A Two-component response regulator YESN; structural genomics, PSI-2, protein structure initiative, MCSG; 2.05A {Fusobacterium nucleatum} Back     alignment and structure
>1mkm_A ICLR transcriptional regulator; structural genomics, winged helix-turn-helix, PSI, protein structure initiative; 2.20A {Thermotoga maritima} SCOP: a.4.5.33 d.110.2.2 Back     alignment and structure
>1p6r_A Penicillinase repressor; transcription regulation, DNA-binding, winged helix protein, bacterial resistance to antibiotics; NMR {Bacillus licheniformis} SCOP: a.4.5.39 PDB: 2p7c_B Back     alignment and structure
>3by6_A Predicted transcriptional regulator; structural genomics, PSI-2, MCSG, structure initiative, midwest center for structural genomic binding; 2.20A {Oenococcus oeni} Back     alignment and structure
>3cuq_B Vacuolar protein-sorting-associated protein 36; ESCRT, MBV, VPS, nucleus, protein transport, transc transcription regulation, transport, endosome; 2.61A {Homo sapiens} PDB: 2zme_B Back     alignment and structure
>3o2p_E Cell division control protein 53; ligase, cell cycle; 2.23A {Saccharomyces cerevisiae} PDB: 3o6b_B Back     alignment and structure
>3mkl_A HTH-type transcriptional regulator GADX; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.15A {Escherichia coli} Back     alignment and structure
>2qq9_A Diphtheria toxin repressor; regulator, DTXR, helix-turn-helix, metal ION, ACT DNA-binding, ferrous iron, transcription; 1.71A {Corynebacterium diphtheriae} PDB: 2tdx_A 1ddn_A 1g3t_A 1g3s_A 1g3w_A 2qqa_A 2qqb_A 2dtr_A 1bi0_A 1bi2_A 1bi3_A 1dpr_A 1bi1_A 1fwz_A 1g3y_A 1c0w_A* 3glx_A 1p92_A 1xcv_A 1f5t_A ... Back     alignment and structure
>1pdn_C Protein (PRD paired); protein-DNA complex, double helix, PAX, paired domain, DNA-binding protein, gene regulation/DNA complex; HET: DNA; 2.50A {Drosophila melanogaster} SCOP: a.4.1.5 Back     alignment and structure
>2ba3_A NIKA; dimer, bacterial conjugation, relaxase, DNA binding, ribbon- helix-helix, DNA binding protein; NMR {Plasmid R64} Back     alignment and structure
>1bl0_A Protein (multiple antibiotic resistance protein), DNA (5'- D(*CP*CP*GP*AP*TP*GP*CP*CP*AP*CP*GP*TP*TP*TP*TP*GP*CP*TP*AP *AP*AP*TP* CP*C)-3')...; transcriptional activator; HET: DNA; 2.30A {Escherichia coli} SCOP: a.4.1.8 a.4.1.8 PDB: 1xs9_A Back     alignment and structure
>2do7_A Cullin-4B, CUL-4B; helix-turn-helix motif, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3chm_A COP9 signalosome complex subunit 7; heat/ARM repeats, winged helix motif, developmental protein, phosphoprotein; 1.50A {Arabidopsis thaliana} Back     alignment and structure
>3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} Back     alignment and structure
>1iuy_A Cullin-3 homologue; winged helix, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: a.4.5.34 Back     alignment and structure
>2co5_A Viral protein F93; viral protein-winged helix complex, winged helix, DNA-bindin WHTH, disulfide bond, STIV; 2.2A {Sulfolobus turreted icosahedral virus} SCOP: a.4.5.48 Back     alignment and structure
>3cta_A Riboflavin kinase; structural genomics, transferase, PSI-2, protein structure initiative; 2.20A {Thermoplasma acidophilum dsm 1728} SCOP: a.4.5.28 b.43.5.2 Back     alignment and structure
>1p4x_A Staphylococcal accessory regulator A homologue; winged-helix protein, transcription; 2.20A {Staphylococcus aureus} SCOP: a.4.5.28 a.4.5.28 Back     alignment and structure
>1fx7_A Iron-dependent repressor IDER; DTXR, iron-dependent regulator, signaling protein; 2.00A {Mycobacterium tuberculosis} SCOP: a.4.5.24 a.76.1.1 b.34.1.2 PDB: 1u8r_A Back     alignment and structure
>3l7w_A Putative uncharacterized protein SMU.1704; PADR, transcriptional factor, transcription; HET: MSE; 2.20A {Streptococcus mutans} SCOP: a.4.5.0 Back     alignment and structure
>2ek5_A Predicted transcriptional regulators; helix-turn-helix, interwined alpha helices; 2.20A {Corynebacterium glutamicum atcc 13032} PDB: 2du9_A Back     alignment and structure
>1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 Back     alignment and structure
>2vn2_A DNAD, chromosome replication initiation protein; DNA replication, primosome; 2.3A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2y75_A HTH-type transcriptional regulator CYMR; DNA binding protein; 2.00A {Bacillus subtilis} Back     alignment and structure
>1sd4_A Penicillinase repressor; BLAI, MECI, methicillin, B-lactam, DNA binding PR; 2.00A {Staphylococcus aureus} SCOP: a.4.5.39 PDB: 1xsd_A Back     alignment and structure
>3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* Back     alignment and structure
>3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* Back     alignment and structure
>1k78_A Paired box protein PAX5; paired domain, ETS domain, transcription factor, transcription/DNA complex; 2.25A {Homo sapiens} SCOP: a.4.1.5 a.4.1.5 PDB: 1mdm_A 6pax_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 243
d1wi9a_72 a.4.5.47 (A:) Hypothetical protein C20orf116 homol 2e-32
>d1wi9a_ a.4.5.47 (A:) Hypothetical protein C20orf116 homolog {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: PCI domain (PINT motif)
domain: Hypothetical protein C20orf116 homolog
species: Mouse (Mus musculus) [TaxId: 10090]

 Score =  110 bits (278), Expect = 2e-32
 Identities = 34/64 (53%), Positives = 44/64 (68%)

Query: 131 GDRDLLADFVEYIKKHKCIPLEDLAAEFKLRTQECINRITSLENMGRLSGVMDDRGKYIY 190
           G    L +F+ YIKK K + LEDLA +  LRTQ+ INRI  L   G L+GV+DDRGK+IY
Sbjct: 4   GSSGFLTEFINYIKKSKVVLLEDLAFQMGLRTQDAINRIQDLLTEGTLTGVIDDRGKFIY 63

Query: 191 ISQA 194
           I+ +
Sbjct: 64  ITPS 67

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query243
d1wi9a_72 Hypothetical protein C20orf116 homolog {Mouse (Mus 100.0
d1ufma_84 COP9 signalosome complex subunit 4, GSN4 {Mouse (M 96.47
d1ub9a_100 Hypothetical protein PH1061 {Archaeon Pyrococcus h 96.39
d2cg4a163 Regulatory protein AsnC {Escherichia coli [TaxId: 96.21
d2cfxa163 Transcriptional regulator LrpC {Bacillus subtilis 96.17
d2etha1140 Putative transcriptional regulator TM0816 {Thermot 96.06
d2cyya160 Putative transcriptional regulator PH1519 {Archaeo 95.98
d1i1ga160 LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} 95.86
d3broa1135 Transcriptional regulator OEOE1854 {Oenococcus oen 95.78
d1z91a1137 Organic hydroperoxide resistance transcriptional r 95.72
d1biaa163 Biotin repressor, N-terminal domain {Escherichia c 95.69
d3ctaa185 Ta1064 (RFK), N-terminal domain {Thermoplasma acid 95.66
d2fbia1136 Probable transcriptional regulator PA4135 {Pseudom 95.55
d2bv6a1136 Transcriptional regulator MgrA {Staphylococcus aur 95.39
d2a61a1139 Transcriptional regulator TM0710 {Thermotoga marit 95.08
d2hr3a1145 Probable transcriptional regulator PA3067 {Pseudom 95.07
d1j5ya165 Putative transcriptional regulator TM1602, N-termi 94.9
d1jgsa_138 Multiple antibiotic resistance repressor, MarR {Es 94.86
d3deua1140 Transcriptional regulator SlyA {Salmonella typhimu 94.59
d2frha1115 Pleiotropic regulator of virulence genes, SarA {St 94.58
d1p4xa1125 Staphylococcal accessory regulator A homolog, SarS 94.57
d1lj9a_144 Transcriptional regulator SlyA {Enterococcus faeca 94.56
d1s3ja_143 Putative transcriptional regulator YusO {Bacillus 94.44
d1hsja1115 Staphylococcal accessory regulator A homolog, SarR 94.31
d1p4xa2125 Staphylococcal accessory regulator A homolog, SarS 94.25
d2d1ha1109 Hypothetical transcriptional regulator ST1889 {Sul 94.23
d2fbha1137 Transcriptional regulator PA3341 {Pseudomonas aeru 93.78
d1ldja190 Anaphase promoting complex (APC) {Human (Homo sapi 93.78
d1lnwa_141 MexR repressor {Pseudomonas aeruginosa [TaxId: 287 93.26
d2fxaa1162 Protease production regulatory protein Hpr {Bacill 93.24
d1jhfa171 LexA repressor, N-terminal DNA-binding domain {Esc 93.2
d1iuya_92 Cullin-3 homologue {Mouse (Mus musculus) [TaxId: 1 92.18
d2ev0a161 Manganese transport regulator MntR {Bacillus subti 91.76
d1sfxa_109 Hypothetical protein AF2008 {Archaeoglobus fulgidu 91.62
d1r1ta_98 SmtB repressor {Cyanobacteria (Synechococcus), pcc 90.37
d2gaua181 Transcriptional regulator PG0396, C-terminal domai 89.97
d3bwga178 Transcriptional regulator YydK {Bacillus subtilis 89.78
d1ft9a180 CO-sensing protein CooA, C-terminal domain {Rhodos 89.04
d2isya163 Iron-dependent regulator IdeR {Mycobacterium tuber 88.76
d1mkma175 Transcriptional regulator IclR, N-terminal domain 88.64
d1z05a171 Transcriptional regulator VC2007 N-terminal domain 88.37
d1ku9a_151 DNA-binding protein Mj223 {Archaeon Methanococcus 87.4
d1u2wa1108 Cadmium efflux system accessory protein CadC {Stap 85.79
d2hs5a169 Putative transcriptional regulator RHA1_ro03477 {R 84.8
d1r1ua_94 Metal-sensing transcriptional repressor CzrA {Stap 84.34
d2bgca1100 Listeriolysin regulatory protein PrfA, C-terminal 83.92
d1dpua_69 C-terminal domain of RPA32 {Human (Homo sapiens) [ 83.89
d2fbka1172 Transcriptional regulator DR1159 {Deinococcus radi 83.85
d2p4wa1194 Transcriptional regulatory protein PF1790 {Pyrococ 82.88
d2hyec184 Cullin-4A {Human (Homo sapiens) [TaxId: 9606]} 82.55
d1i5za169 Catabolite gene activator protein (CAP), C-termina 80.08
>d1wi9a_ a.4.5.47 (A:) Hypothetical protein C20orf116 homolog {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: PCI domain (PINT motif)
domain: Hypothetical protein C20orf116 homolog
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=100.00  E-value=3.7e-34  Score=212.27  Aligned_cols=64  Identities=53%  Similarity=0.902  Sum_probs=62.2

Q ss_pred             cchhHHHHHHHHHHhcCccchHHHHHHcCCChHHHHHHHHHHHhcCCcceeeeCCCCeEEEcHH
Q 026130          131 GDRDLLADFVEYIKKHKCIPLEDLAAEFKLRTQECINRITSLENMGRLSGVMDDRGKYIYISQA  194 (243)
Q Consensus       131 ~~~~lL~~Fi~yIK~~KvV~LEdLA~~F~lrtqd~I~RIq~Le~~g~LtGViDDRGKFIYIS~e  194 (243)
                      .+++||++||+|||.+|||+|||||++|||+|||||+||++|+++|+||||||||||||||||.
T Consensus         4 ~~q~lL~~FI~~Ik~~Kvv~LedLAa~F~lktqd~i~RIq~Le~~g~ltGViDDRGKfIyIS~s   67 (72)
T d1wi9a_           4 GSSGFLTEFINYIKKSKVVLLEDLAFQMGLRTQDAINRIQDLLTEGTLTGVIDDRGKFIYITPS   67 (72)
T ss_dssp             SSCCHHHHHHHHHHHCSEECHHHHHHHHCSCHHHHHHHHHHHHHHSSSCEEECTTCCEEECCCS
T ss_pred             chHHHHHHHHHHHHHCCEeeHHHHHHHcCCcHHHHHHHHHHHHHCCCeeeEEcCCCCEEEEcCC
Confidence            4789999999999999999999999999999999999999999999999999999999999984
>d1ufma_ a.4.5.47 (A:) COP9 signalosome complex subunit 4, GSN4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ub9a_ a.4.5.28 (A:) Hypothetical protein PH1061 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2cg4a1 a.4.5.32 (A:4-66) Regulatory protein AsnC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cfxa1 a.4.5.32 (A:1-63) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2etha1 a.4.5.28 (A:1-140) Putative transcriptional regulator TM0816 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2cyya1 a.4.5.32 (A:5-64) Putative transcriptional regulator PH1519 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1i1ga1 a.4.5.32 (A:2-61) LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d3broa1 a.4.5.28 (A:3-137) Transcriptional regulator OEOE1854 {Oenococcus oeni [TaxId: 1247]} Back     information, alignment and structure
>d1z91a1 a.4.5.28 (A:8-144) Organic hydroperoxide resistance transcriptional regulator OhrR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1biaa1 a.4.5.1 (A:1-63) Biotin repressor, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3ctaa1 a.4.5.28 (A:5-89) Ta1064 (RFK), N-terminal domain {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2fbia1 a.4.5.28 (A:5-140) Probable transcriptional regulator PA4135 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2bv6a1 a.4.5.28 (A:5-140) Transcriptional regulator MgrA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2a61a1 a.4.5.28 (A:5-143) Transcriptional regulator TM0710 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2hr3a1 a.4.5.28 (A:2-146) Probable transcriptional regulator PA3067 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1j5ya1 a.4.5.1 (A:3-67) Putative transcriptional regulator TM1602, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jgsa_ a.4.5.28 (A:) Multiple antibiotic resistance repressor, MarR {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3deua1 a.4.5.28 (A:2-141) Transcriptional regulator SlyA {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2frha1 a.4.5.28 (A:102-216) Pleiotropic regulator of virulence genes, SarA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1p4xa1 a.4.5.28 (A:1-125) Staphylococcal accessory regulator A homolog, SarS {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1lj9a_ a.4.5.28 (A:) Transcriptional regulator SlyA {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1s3ja_ a.4.5.28 (A:) Putative transcriptional regulator YusO {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1hsja1 a.4.5.28 (A:373-487) Staphylococcal accessory regulator A homolog, SarR {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1p4xa2 a.4.5.28 (A:126-250) Staphylococcal accessory regulator A homolog, SarS {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2d1ha1 a.4.5.50 (A:1-109) Hypothetical transcriptional regulator ST1889 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2fbha1 a.4.5.28 (A:8-144) Transcriptional regulator PA3341 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ldja1 a.4.5.34 (A:687-776) Anaphase promoting complex (APC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lnwa_ a.4.5.28 (A:) MexR repressor {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2fxaa1 a.4.5.28 (A:6-167) Protease production regulatory protein Hpr {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jhfa1 a.4.5.2 (A:2-72) LexA repressor, N-terminal DNA-binding domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iuya_ a.4.5.34 (A:) Cullin-3 homologue {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ev0a1 a.4.5.24 (A:2-62) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1sfxa_ a.4.5.50 (A:) Hypothetical protein AF2008 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1r1ta_ a.4.5.5 (A:) SmtB repressor {Cyanobacteria (Synechococcus), pcc7942 [TaxId: 1129]} Back     information, alignment and structure
>d2gaua1 a.4.5.4 (A:152-232) Transcriptional regulator PG0396, C-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d3bwga1 a.4.5.6 (A:5-82) Transcriptional regulator YydK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ft9a1 a.4.5.4 (A:134-213) CO-sensing protein CooA, C-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d2isya1 a.4.5.24 (A:2-64) Iron-dependent regulator IdeR {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mkma1 a.4.5.33 (A:1-75) Transcriptional regulator IclR, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z05a1 a.4.5.63 (A:10-80) Transcriptional regulator VC2007 N-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1ku9a_ a.4.5.36 (A:) DNA-binding protein Mj223 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1u2wa1 a.4.5.5 (A:12-119) Cadmium efflux system accessory protein CadC {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2hs5a1 a.4.5.6 (A:25-93) Putative transcriptional regulator RHA1_ro03477 {Rhodococcus sp. RHA1 [TaxId: 101510]} Back     information, alignment and structure
>d1r1ua_ a.4.5.5 (A:) Metal-sensing transcriptional repressor CzrA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2bgca1 a.4.5.4 (A:138-237) Listeriolysin regulatory protein PrfA, C-terminal domain {Bacteria (Listeria monocytogenes) [TaxId: 1639]} Back     information, alignment and structure
>d1dpua_ a.4.5.16 (A:) C-terminal domain of RPA32 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbka1 a.4.5.28 (A:8-179) Transcriptional regulator DR1159 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2p4wa1 a.4.5.64 (A:1-194) Transcriptional regulatory protein PF1790 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2hyec1 a.4.5.34 (C:676-759) Cullin-4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i5za1 a.4.5.4 (A:138-206) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure