Citrus Sinensis ID: 026131

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240---

MSWLLVIVSTIVVWVASLFKILNSSRSQSNAAFLTTGDKKNVLLVIAHPDDESMFFSPTINYLTSRRHNLHILCMSNGNADGMGNIRKDELHRACAVLKIPLEQVKVLDLVDFQDGFDKLWNHKSLAKIVEEEVVNCSIDLIITFDNYGVSGHCNHRDVHHGIWSYLNGTSERNIEAWELMTTNILRKYSGPLDIWLSILSATQYRRGQVHCLLNEHPKKSFLAMSQHHSQWVWCDFLYSFNP

cHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEEEcccccccccHHHHHHHHHHccccEEEEEccccccccccHHHHHHHHHHHHHHccccccEEEcccccccccccccccHHHHHHHHHHHHHHccccEEEEEccccccccccHHHHHHHHHHHHHcccccccHHHHHccccccccccccHHHHHHHHHccccccccEEEcccccHHHHHHHHHHccHHHHHHHHHEEccc

MSWLLVIVSTIVVWVASLFKILNSSR**SNAAFLTTGDKKNVLLVIAHPDDESMFFSPTINYLTSRRHNLHILCMSNGNADGMGNIRKDELHRACAVLKIPLEQVKVLDLVDFQDGFDKLWNHKSLAKIVEEEVVNCSIDLIITFDNYGVSGHCNHRDVHHGIWSYLNGTSERNIEAWELMTTNILRKYSGPLDIWLSILSATQYRRGQVHCLLNEHPKKSFLAMSQHHSQWVWCDFLYSFNP

xxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase	Involved in the second step of GPI biosynthesis. De-N-acetylation of N-acetylglucosaminyl-phosphatidylinositol.	probable	Q9HDW9
N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase	Involved in the second step of GPI biosynthesis. De-N-acetylation of N-acetylglucosaminyl-phosphatidylinositol.	probable	Q9Y2B2
N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase	Involved in the second step of GPI biosynthesis. De-N-acetylation of N-acetylglucosaminyl-phosphatidylinositol.	probable	O35790

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1Q74, chain A
Confidence level:very confident
Coverage over the Query: 39-217
View the alignment between query and template
View the model in PyMOL