Citrus Sinensis ID: 026143


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240---
MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCSYGAVEVNKPAKELESSYREYLKLKTRFESLQRTQRNLLGEDLGPLNSKELEQLERQLESSLKHVRSTKTQYMLDQLSDLQNKEQLLLDTNRALTIKLDEINAKTQLRPSWEGGEQQLGYNPQHAQTQGLFQPIECNPTLQIGYNPSCSDQMTATSHAQQVSGFIPGWML
ccccccccccccccccccccccccccccHHHHHHHHHHccccEEEEEEccccccccccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCSYGAVEVN*********YREYLKLKTRFESLQRTQRNLLGEDLGPLNSKELEQLERQLESSLKHVRSTKTQYMLDQLSDLQNKEQLLLDTNRALTIKLDEIN**************************GLFQPIECNPTLQIGYN******************FIPGWML
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCSYGAVEVNKPAKELESSYREYLKLKTRFESLQRTQRNLLGEDLGPLNSKExxxxxxxxxxxxxxxxxxxxxYMLDQLSDLQNKEQLLLDTNRALTIKLDEINAKTQLRPSWEGGEQQLGYNPQHAQTQGLFQPIECNPTLQIGYNPSCSDQMTATSHAQQVSGFIPGWML

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Developmental protein SEPALLATA 2 Probable transcription factor. Functions with SEPALLATA1/AGL2 and SEPALLATA3/AGL9 to ensure proper development of petals, stamens and carpels and to prevent the indeterminate growth of the flower meristem. Forms an heterodimer via the K-box domain with AG, that could be involved in genes regulation during floral meristem development.confidentP29384
MADS-box transcription factor 8 Probable transcription factor. May be involved in the control of flowering time.probableQ9SAR1
Developmental protein SEPALLATA 1 Probable transcription factor. Functions with SEPALLATA2/AGL4 and SEPALLATA3/AGL9 to ensure proper development of petals, stamens and carpels, and to prevent the indeterminate growth of the flower meristem. Forms an heterodimer via the K-box domain with AGAMOUS, that could be involved in genes regulation during floral meristem development.probableP29382

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1K6O, chain B
Confidence level:very confident
Coverage over the Query: 1-77
View the alignment between query and template
View the model in PyMOL
Template: 2JEE, chain A
Confidence level:probable
Coverage over the Query: 119-169
View the alignment between query and template
View the model in PyMOL