Citrus Sinensis ID: 026146


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240--
MEETNKNKNKYSIIIPTYNERLNIALIVYLIFKHLRDVDFEIIVVDDGSPDGTQEVVKQLQQLYGEDRILLRPRPKKLGLGTAYIHGLKHASGSFVVIMDADLSHHPKYLPSFIKKQLETGASIVTGTRYVRSGGVHGWNLMRKLTSRGANVLAQTLLWPGVSDLTGSFRLYKKSVLEDVISSCVSKGYVFQMEMIVRACRKGYHIEEVPITFVDRVFGSSKLGGSEIVEYLKGLLYLLITT
ccccccccccEEEEEccccccccHHHHHHHHHHHccccccEEEEEEccccccHHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHccccEEEEEccccccccccHHHHHHHHHHccccEEEEEEEEccccccccccHHHHHHHHHHHHHHHHcccccccccccEEEEEHHHHHHHHcccccccccHHHHHHHHHHHcccEEEEEcEEEcccccccccccHHHHHHHHHHHHHHHHcc
**********YSIIIPTYNERLNIALIVYLIFKHLRDVDFEIIVVDDGSPDGTQEVVKQLQQLYGEDRILLRPRPKKLGLGTAYIHGLKHASGSFVVIMDADLSHHPKYLPSFIKKQLETGASIVTGTRYVRSGGVHGWNLMRKLTSRGANVLAQTLLWPGVSDLTGSFRLYKKSVLEDVISSCVSKGYVFQMEMIVRACRKGYHIEEVPITFVDRVFGSSKLGGSEIVEYLKGLLYLLITT
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEETNKNKNKYSIIIPTYNERLNIALIVYLIFKHLRDVDFEIIVVDDGSPDGTQEVVKQLQQLYGEDRILLRPRPKKLGLGTAYIHGLKHASGSFVVIMDADLSHHPKYLPSFIKKQLETGASIVTGTRYVRSGGVHGWNLMRKLTSRGANVLAQTLLWPGVSDLTGSFRLYKKSVLEDVISSCVSKGYVFQMEMIVRACRKGYHIEEVPITFVDRVFGSSKLGGSEIVEYLKGLLYLLITT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Dolichol-phosphate mannosyltransferase Transfers mannose from GDP-mannose to dolichol monophosphate to form dolichol phosphate mannose (Dol-P-Man) which is the mannosyl donor in pathways leading to N-glycosylation, glycosyl phosphatidylinositol membrane anchoring, and O-mannosylation of proteins.probableQ9WU83
Dolichol-phosphate mannosyltransferase Transfers mannose from GDP-mannose to dolichol monophosphate to form dolichol phosphate mannose (Dol-P-Man) which is the mannosyl donor in pathways leading to N-glycosylation, glycosyl phosphatidylinositol membrane anchoring, and O-mannosylation of proteins.probableQ1JQ93
Dolichol-phosphate mannosyltransferase Transfers mannose from GDP-mannose to dolichol monophosphate to form dolichol phosphate mannose (Dol-P-Man) which is the mannosyl donor in pathways leading to N-glycosylation, glycosyl phosphatidylinositol membrane anchoring, and O-mannosylation of proteins.probableO70152

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.4.-.-Glycosyltransferases.probable
2.4.1.-Hexosyltransferases.probable
2.4.1.83Dolichyl-phosphate beta-D-mannosyltransferase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Z86, chain A
Confidence level:very confident
Coverage over the Query: 6-220
View the alignment between query and template
View the model in PyMOL
Template: 4HG6, chain A
Confidence level:confident
Coverage over the Query: 6-240
View the alignment between query and template
View the model in PyMOL