Citrus Sinensis ID: 026159

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240--
MTVAAGIGYALIALGPSLSLFVAVISKKPFLILTVLSSTLLWLISLIVLSGIWRAFLPLKSTTWWPFALLIISSVGFQEGLRVLFWKVYKRLEDTLDAFADRVGKPRLFLTDKMQIALAGGLGHGVAHAVFFCLSLLTPAFGPATFYVDRCPQMPFFLISAIIALAFVTIHTFSMVIAFNGYAEGNTTDQYFVPVVHLVAGMVTLVNFASGGCVVGIPLLYILASLILLHCGKMVWRRLTAS
ccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEcccccccccHHHHHHHHHHHHHHHHHHHHHEEEcccccccEEEEEEHHHHHHHHHHHHHHccccccCEEHHHHHHHHHHHHHHHHHHHHHHccccc
MTVAAGIGYALIALGPSLSLFVAVISKKPFLILTVLSSTLLWLISLIVLSGIWRAFLPLKSTTWWPFALLIISSVGFQEGLRVLFWKVYKRLEDTLDAFADRVGKPRLFLTDKMQIALAGGLGHGVAHAVFFCLSLLTPAFGPATFYVDRCPQMPFFLISAIIALAFVTIHTFSMVIAFNGYAEGNTTDQYFVPVVHLVAGMVTLVNFASGGCVVGIPLLYILASLILLHCGKMVWRRL***
xxxxxHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHHHxHxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTVAAGIGYALIALGPSLSLFVAVISKKPFLILTVLSSTLLWLISLIVLSGIWRAFLPLKSTTWWPFALLIISSVGFQEGLRVLFWKVYKRLEDTLDAFADRVGKPRLFLTDKMQIALAGGLGHGVAHAVFFCLSLLTPAFGPATFYVDRCPQMPFFLISAIIALAFVTIHTFSMVIAFNGYAEGNTTDQYFVPVVHLVAGMVTLVNFASGGCVVGIPLLYILASLILLHCGKMVWRRLTAS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Gamma-secretase subunit APH1-like Probable subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral proteins such as Notch receptors.confidentQ8L9G7
Gamma-secretase subunit Aph-1 Essential subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch. It probably represents a stabilizing cofactor for the presenilin homodimer that promotes the formation of a stable complex.probableQ9VQG2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted