Citrus Sinensis ID: 026166

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240--
MEEKPQVHVPRVKLGSQGLEVSRLGFGCGGLSGIYNKPLSHEVGCSIIKETFNRGITLFDTSDVYGVDHDNEIMVGKALKQLPRDKIQLATKFGCFMLDGVSIGVKGSPEYVRKCCEASLKRLDVDYIDLYYQHRVDTSVSIEDTMGELKKLVEEGKIKYIGLSEASADTIRRAHAVHPITAVQMEYSLWTREIEDDIIPLCRELGIGIVAYSPLGRGFFAGKAVVESLPSESILVCVTKQI
ccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHcccccccEEEEEEccEEEcccccccccccHHHHHHHHHHHHcccccccEEccccccccccccHHHHHHHHHHHHHcccccEEEcccccHHHHHHHHccccccHHHHHcccccccccHHHHHHHHHHccEEEEccccccccccccccccccccccccccccccc
ccccccccccEEEccccccEEEHcccccccccccccccccHHHHHHHHHHHHHccccEEcccccccccccHHHHHHHHHccccccEEEEEEEccEEccccccccccccHHHHHHHHHHHHHHHccccEEEEEEccccccccHHHHHHHHHHHHHcccEEEEEEEcccHHHHHHHHccccEEEEEcccccccccHHHHHHHHHHHcccEEEEccccccccccccccccccccccccccccccc
meekpqvhvprvklgsqglevsrlgfgcgglsgiynkplshevgCSIIKETFNrgitlfdtsdvygvdhdneiMVGKALKQLPRDKIQLATKFGcfmldgvsigvkgspeyVRKCCEASLKRLDVDYIDLYYQHRVDTSVSIEDTMGELKKLVEEGKIKYIGLSEASADTIRRAHAVHPITAVQMEYSLWTREIEDDIIPLCRELgigivaysplgrgfFAGKAVveslpsesILVCVTKQI
meekpqvhvprvklgsqglEVSRLGFGCGGLSGIYNKPLSHEVGCSIIKETFNRGITLFDTSDVYGVDHDNEIMVGKALKQLPRDKIQLATKFGCFMLDGVSigvkgspeyVRKCCEASLKRLDVDYIDLYYQHRVDTSVSIEDTMGELKKLVEEGKIKYIGLSEASADTIRRAHAVHPITAVQMEYSLWTREIEDDIIPLCRELGIGIVAYSPLGRGFFAGKAVVeslpsesilvcvtkqi
MEEKPQVHVPRVKLGSQGLEVSRLGFGCGGLSGIYNKPLSHEVGCSIIKETFNRGITLFDTSDVYGVDHDNEIMVGKALKQLPRDKIQLATKFGCFMLDGVSIGVKGSPEYVRKCCEASLKRLDVDYIDLYYQHRVDTSVSIEDTMGELKKLVEEGKIKYIGLSEASADTIRRAHAVHPITAVQMEYSLWTREIEDDIIPLCRELGIGIVAYSPLGRGFFAGKAVVESLPSESILVCVTKQI
***************SQGLEVSRLGFGCGGLSGIYNKPLSHEVGCSIIKETFNRGITLFDTSDVYGVDHDNEIMVGKALKQLPRDKIQLATKFGCFMLDGVSIGVKGSPEYVRKCCEASLKRLDVDYIDLYYQHRVDTSVSIEDTMGELKKLVEEGKIKYIGLSEASADTIRRAHAVHPITAVQMEYSLWTREIEDDIIPLCRELGIGIVAYSPLGRGFFAGKAVVESLPSESILVCV****
**************GSQGLEVSRLGFGCGGLSGIYNKPLSHEVGCSIIKETFNRGITLFDTSDVYGVDHDNEIMVGKALKQLPRDKIQLATKFGCFMLDGVSIGVKGSPEYVRKCCEASLKRLDVDYIDLYYQHRVDTSVSIEDTMGELKKLVEEGKIKYIGLSEASADTIRRAHAVHPITAVQMEYSLWTREIEDDIIPLCRELGIGIVAYSPLGRGFFAGKAVVESLPSESILVCVTKQ*
*********PRVKLGSQGLEVSRLGFGCGGLSGIYNKPLSHEVGCSIIKETFNRGITLFDTSDVYGVDHDNEIMVGKALKQLPRDKIQLATKFGCFMLDGVSIGVKGSPEYVRKCCEASLKRLDVDYIDLYYQHRVDTSVSIEDTMGELKKLVEEGKIKYIGLSEASADTIRRAHAVHPITAVQMEYSLWTREIEDDIIPLCRELGIGIVAYSPLGRGFFAGKAVVESLPSESILVCVTKQI
******VHVPRVKLGSQGLEVSRLGFGCGGLSGIYNKPLSHEVGCSIIKETFNRGITLFDTSDVYGVDHDNEIMVGKALKQLPRDKIQLATKFGCFMLDGVSIGVKGSPEYVRKCCEASLKRLDVDYIDLYYQHRVDTSVSIEDTMGELKKLVEEGKIKYIGLSEASADTIRRAHAVHPITAVQMEYSLWTREIEDDIIPLCRELGIGIVAYSPLGRGFFAGKAVV****************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEEKPQVHVPRVKLGSQGLEVSRLGFGCGGLSGIYNKPLSHEVGCSIIKETFNRGITLFDTSDVYGVDHDNEIMVGKALKQLPRDKIQLATKFGCFMLDGVSIGVKGSPEYVRKCCEASLKRLDVDYIDLYYQHRVDTSVSIEDTMGELKKLVEEGKIKYIGLSEASADTIRRAHAVHPITAVQMEYSLWTREIEDDIIPLCRELGIGIVAYSPLGRGFFAGKAVVESLPSESILVCVTKQI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query242 2.2.26 [Sep-21-2011]
Q3L181 337 Perakine reductase OS=Rau N/A no 0.942 0.676 0.714 3e-94
C6TBN2 346 Probable aldo-keto reduct no no 0.946 0.661 0.704 1e-93
Q93ZN2 345 Probable aldo-keto reduct yes no 0.904 0.634 0.671 9e-78
A2XRZ0 351 Probable aldo-keto reduct N/A no 0.904 0.623 0.666 2e-77
Q84M96 346 Probable aldo-keto reduct no no 0.921 0.644 0.64 3e-77
Q7XT99 351 Probable aldo-keto reduct no no 0.904 0.623 0.662 1e-76
P40691307 Auxin-induced protein PCN N/A no 0.921 0.726 0.641 3e-76
F4HPY8330 Probable aldo-keto reduct no no 0.876 0.642 0.652 6e-76
O22707 345 Probable aldo-keto reduct no no 0.904 0.634 0.644 2e-75
P49249306 IN2-2 protein OS=Zea mays N/A no 0.913 0.722 0.642 3e-75
>sp|Q3L181|PERR_RAUSE Perakine reductase OS=Rauvolfia serpentina GN=PR PE=1 SV=1 Back     alignment and function desciption
 Score =  344 bits (883), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 163/228 (71%), Positives = 192/228 (84%)

Query: 9   VPRVKLGSQGLEVSRLGFGCGGLSGIYNKPLSHEVGCSIIKETFNRGITLFDTSDVYGVD 68
           +PRVKLG+QGLEVS+LGFGC GLSG YN  L  E G ++IKE FN GIT FDTSD+YG +
Sbjct: 1   MPRVKLGTQGLEVSKLGFGCMGLSGDYNDALPEEQGIAVIKEAFNCGITFFDTSDIYGEN 60

Query: 69  HDNEIMVGKALKQLPRDKIQLATKFGCFMLDGVSIGVKGSPEYVRKCCEASLKRLDVDYI 128
             NE ++GKALKQLPR+KIQ+ TKFG   +    +  KG+P+YVR CCEASLKRLDVDYI
Sbjct: 61  GSNEELLGKALKQLPREKIQVGTKFGIHEIGFSGVKAKGTPDYVRSCCEASLKRLDVDYI 120

Query: 129 DLYYQHRVDTSVSIEDTMGELKKLVEEGKIKYIGLSEASADTIRRAHAVHPITAVQMEYS 188
           DL+Y HR+DT+V IE TMGELKKLVEEGKIKY+GLSEAS DTIRRAHAVHP+TA+Q+EYS
Sbjct: 121 DLFYIHRIDTTVPIEITMGELKKLVEEGKIKYVGLSEASPDTIRRAHAVHPVTALQIEYS 180

Query: 189 LWTREIEDDIIPLCRELGIGIVAYSPLGRGFFAGKAVVESLPSESILV 236
           LWTR+IED+I+PLCR+LGIGIV YSP+GRG FAGKA+ ESLP  S+L 
Sbjct: 181 LWTRDIEDEIVPLCRQLGIGIVPYSPIGRGLFAGKAIKESLPENSVLT 228
Aldo-keto reductase involved in the biosynthesis of monoterpenoid indole alkaloids. Broad substrate specificity enzyme with a high selectivity in the group of alkaloids. Can use perakine, 19(S),20(R)-dihydro-peraksine-17,21-al, cinnamic aldehyde, p-coumaric aldehyde and 3-(3,4,5-trimethoxyphenyl)propanal as substrates, but not ketosteroids such as progesterone. NADPH could not be replaced by NADH.
Rauvolfia serpentina (taxid: 4060)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 3EC: 1EC: 7
>sp|C6TBN2|AKR1_SOYBN Probable aldo-keto reductase 1 OS=Glycine max GN=AKR1 PE=2 SV=1 Back     alignment and function description
>sp|Q93ZN2|ALKR4_ARATH Probable aldo-keto reductase 4 OS=Arabidopsis thaliana GN=At1g60710 PE=1 SV=1 Back     alignment and function description
>sp|A2XRZ0|AKR2_ORYSI Probable aldo-keto reductase 2 OS=Oryza sativa subsp. indica GN=OsI_15387 PE=3 SV=1 Back     alignment and function description
>sp|Q84M96|ALKR2_ARATH Probable aldo-keto reductase 2 OS=Arabidopsis thaliana GN=AGD2 PE=1 SV=1 Back     alignment and function description
>sp|Q7XT99|AKR2_ORYSJ Probable aldo-keto reductase 2 OS=Oryza sativa subsp. japonica GN=Os04g0338000 PE=2 SV=2 Back     alignment and function description
>sp|P40691|A115_TOBAC Auxin-induced protein PCNT115 OS=Nicotiana tabacum PE=2 SV=1 Back     alignment and function description
>sp|F4HPY8|AKR6_ARATH Probable aldo-keto reductase 6 OS=Arabidopsis thaliana GN=At1g60750 PE=3 SV=1 Back     alignment and function description
>sp|O22707|ALKR3_ARATH Probable aldo-keto reductase 3 OS=Arabidopsis thaliana GN=At1g60690 PE=3 SV=1 Back     alignment and function description
>sp|P49249|IN22_MAIZE IN2-2 protein OS=Zea mays GN=IN2-2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query242
363808134 348 uncharacterized protein LOC100811411 [Gl 0.962 0.669 0.821 1e-111
363807182 344 uncharacterized protein LOC100810870 [Gl 0.966 0.680 0.811 1e-111
224102117 344 predicted protein [Populus trichocarpa] 0.975 0.686 0.813 1e-111
225432798 345 PREDICTED: auxin-induced protein PCNT115 0.975 0.684 0.813 1e-110
255552045 350 aldo/keto reductase, putative [Ricinus c 0.971 0.671 0.795 1e-108
255552041 343 aldo/keto reductase, putative [Ricinus c 0.962 0.679 0.794 1e-107
255542306 350 aldo/keto reductase, putative [Ricinus c 0.966 0.668 0.763 1e-102
449494865 345 PREDICTED: LOW QUALITY PROTEIN: perakine 0.966 0.678 0.764 1e-102
449455310 345 PREDICTED: LOW QUALITY PROTEIN: perakine 0.966 0.678 0.764 1e-102
449445274 347 PREDICTED: probable aldo-keto reductase 0.966 0.674 0.754 3e-99
>gi|363808134|ref|NP_001242478.1| uncharacterized protein LOC100811411 [Glycine max] gi|255637199|gb|ACU18930.1| unknown [Glycine max] Back     alignment and taxonomy information
 Score =  408 bits (1049), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 193/235 (82%), Positives = 216/235 (91%), Gaps = 2/235 (0%)

Query: 3   EKPQVHVPRVKLGSQGLEVSRLGFGCGGLSGIYNKPLSHEVGCSIIKETFNRGITLFDTS 62
           EK  + VPRVKLG+QGLEVSRLGFGCGGLSGIYN PLSHE GCSIIKE FN+G+T FDTS
Sbjct: 2   EKAHMQVPRVKLGNQGLEVSRLGFGCGGLSGIYNAPLSHEEGCSIIKEVFNKGVTFFDTS 61

Query: 63  DVYGVDHDNEIMVGKALKQLPRDKIQLATKFGCFML--DGVSIGVKGSPEYVRKCCEASL 120
           D+YG +HDNEIMVGKALKQLPR+K+QLATKFG  +   DG+  GVKG+PEYVR+CCEASL
Sbjct: 62  DLYGQNHDNEIMVGKALKQLPREKVQLATKFGVTVSGPDGLDFGVKGTPEYVRQCCEASL 121

Query: 121 KRLDVDYIDLYYQHRVDTSVSIEDTMGELKKLVEEGKIKYIGLSEASADTIRRAHAVHPI 180
           KRLDVD+IDLYYQHRVDTSV IEDTMGELK+ V EGKIKYIGLSEA+AD IRRAHAVHPI
Sbjct: 122 KRLDVDHIDLYYQHRVDTSVPIEDTMGELKQFVNEGKIKYIGLSEANADAIRRAHAVHPI 181

Query: 181 TAVQMEYSLWTREIEDDIIPLCRELGIGIVAYSPLGRGFFAGKAVVESLPSESIL 235
           TA+QMEYSLWTR+IE++IIPLCR+LGIGIVAYSPLGRGFFAGKAVVE+LPS+S+L
Sbjct: 182 TALQMEYSLWTRDIEEEIIPLCRQLGIGIVAYSPLGRGFFAGKAVVETLPSQSLL 236

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|363807182|ref|NP_001242349.1| uncharacterized protein LOC100810870 [Glycine max] gi|255644406|gb|ACU22708.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|224102117|ref|XP_002312553.1| predicted protein [Populus trichocarpa] gi|222852373|gb|EEE89920.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225432798|ref|XP_002283471.1| PREDICTED: auxin-induced protein PCNT115 [Vitis vinifera] gi|297737113|emb|CBI26314.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255552045|ref|XP_002517067.1| aldo/keto reductase, putative [Ricinus communis] gi|223543702|gb|EEF45230.1| aldo/keto reductase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255552041|ref|XP_002517065.1| aldo/keto reductase, putative [Ricinus communis] gi|223543700|gb|EEF45228.1| aldo/keto reductase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255542306|ref|XP_002512216.1| aldo/keto reductase, putative [Ricinus communis] gi|223548177|gb|EEF49668.1| aldo/keto reductase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449494865|ref|XP_004159668.1| PREDICTED: LOW QUALITY PROTEIN: perakine reductase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449455310|ref|XP_004145396.1| PREDICTED: LOW QUALITY PROTEIN: perakine reductase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449445274|ref|XP_004140398.1| PREDICTED: probable aldo-keto reductase 1-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query242
TAIR|locus:2036504 345 ATB2 [Arabidopsis thaliana (ta 0.917 0.643 0.662 3.6e-73
TAIR|locus:2036591 346 AT1G60680 "AT1G60680" [Arabido 0.921 0.644 0.64 1.1e-71
TAIR|locus:2036611 345 AT1G60690 "AT1G60690" [Arabido 0.904 0.634 0.644 9.9e-71
TAIR|locus:2036551330 AT1G60750 [Arabidopsis thalian 0.954 0.7 0.621 9.9e-71
TAIR|locus:2196446 344 AT1G10810 "AT1G10810" [Arabido 0.900 0.633 0.636 1e-68
TIGR_CMR|SPO_A0345327 SPO_A0345 "oxidoreductase, ald 0.863 0.639 0.537 1.3e-52
TIGR_CMR|GSU_3126334 GSU_3126 "oxidoreductase, aldo 0.859 0.622 0.495 7.4e-50
UNIPROTKB|G4NAH9341 MGG_09715 "Aldo-keto reductase 0.880 0.624 0.448 3.9e-44
POMBASE|SPAC1F7.12 340 yak3 "aldose reductase ARK13 f 0.867 0.617 0.465 6.6e-42
ASPGD|ASPL0000072041 351 AN8733 [Emericella nidulans (t 0.847 0.584 0.430 4.2e-40
TAIR|locus:2036504 ATB2 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 739 (265.2 bits), Expect = 3.6e-73, P = 3.6e-73
 Identities = 149/225 (66%), Positives = 174/225 (77%)

Query:     9 VPRVKLGSQGLEVSRLGFGCGGLSGIYNKPLSHEVGCSIIKETFNRGITLFDTSDVYGVD 68
             V R+KLGSQGLEVS  G GC GLS  Y  P       ++I    + G+TL DTSD+YG +
Sbjct:     7 VRRMKLGSQGLEVSAQGLGCMGLSAFYGAPKPENEAIALIHHAIHSGVTLLDTSDIYGPE 66

Query:    69 HDNEIMVGKALKQLPRDKIQLATKFGCFMLDGVSIGVKGSPEYVRKCCEASLKRLDVDYI 128
               NE+++GKALK   R+K++LATKFG    +G    V+G PEYVR  CEASLKRLD+  I
Sbjct:    67 -TNEVLLGKALKDGVREKVELATKFGISYAEGKR-EVRGDPEYVRAACEASLKRLDIACI 124

Query:   129 DLYYQHRVDTSVSIEDTMGELKKLVEEGKIKYIGLSEASADTIRRAHAVHPITAVQMEYS 188
             DLYYQHRVDT V IE TMGELKKLVEEGKIKYIGLSEASA TIRRAHAVHPITAVQ+E+S
Sbjct:   125 DLYYQHRVDTRVPIEITMGELKKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQIEWS 184

Query:   189 LWTREIEDDIIPLCRELGIGIVAYSPLGRGFFA-GKAVVESLPSE 232
             LWTR++E++IIP CRELGIGIVAYSPLGRGFFA G  +VE+L  +
Sbjct:   185 LWTRDVEEEIIPTCRELGIGIVAYSPLGRGFFASGPKLVENLEKD 229
GO:0005737 "cytoplasm" evidence=ISM
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0046686 "response to cadmium ion" evidence=IEP;RCA
GO:0005829 "cytosol" evidence=IDA
GO:0006094 "gluconeogenesis" evidence=RCA
GO:0006096 "glycolysis" evidence=RCA
GO:0009611 "response to wounding" evidence=RCA
GO:0009651 "response to salt stress" evidence=RCA
GO:0009805 "coumarin biosynthetic process" evidence=RCA
GO:0009963 "positive regulation of flavonoid biosynthetic process" evidence=RCA
TAIR|locus:2036591 AT1G60680 "AT1G60680" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036611 AT1G60690 "AT1G60690" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036551 AT1G60750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2196446 AT1G10810 "AT1G10810" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_A0345 SPO_A0345 "oxidoreductase, aldo/keto reductase family" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_3126 GSU_3126 "oxidoreductase, aldo/keto reductase family" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|G4NAH9 MGG_09715 "Aldo-keto reductase yakc" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
POMBASE|SPAC1F7.12 yak3 "aldose reductase ARK13 family YakC" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
ASPGD|ASPL0000072041 AN8733 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q3L181PERR_RAUSE1, ., 1, ., 1, ., 3, 1, 70.71490.94210.6765N/Ano
Q93ZN2ALKR4_ARATH1, ., 1, ., 1, ., -0.67110.90490.6347yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query242
cd06660285 cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) 1e-84
COG0667316 COG0667, Tas, Predicted oxidoreductases (related t 1e-82
pfam00248277 pfam00248, Aldo_ket_red, Aldo/keto reductase famil 2e-66
COG0656280 COG0656, ARA1, Aldo/keto reductases, related to di 2e-41
PLN02587314 PLN02587, PLN02587, L-galactose dehydrogenase 2e-27
COG4989298 COG4989, COG4989, Predicted oxidoreductase [Genera 8e-27
COG1453 391 COG1453, COG1453, Predicted oxidoreductases of the 4e-24
PRK09912346 PRK09912, PRK09912, L-glyceraldehyde 3-phosphate r 1e-23
TIGR01293317 TIGR01293, Kv_beta, voltage-dependent potassium ch 1e-17
PRK10376290 PRK10376, PRK10376, putative oxidoreductase; Provi 3e-17
PRK10625346 PRK10625, tas, putative aldo-keto reductase; Provi 3e-16
PRK11565275 PRK11565, dkgA, 2,5-diketo-D-gluconate reductase A 1e-08
PRK11172267 PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B 4e-08
>gnl|CDD|119408 cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols Back     alignment and domain information 
 Score =  253 bits (648), Expect = 1e-84
 Identities = 97/236 (41%), Positives = 139/236 (58%), Gaps = 12/236 (5%)

Query: 11  RVKLGSQGLEVSRLGFGCGGLSGIYNKPLSHEVGCSIIKETFNRGITLFDTSDVYGVDHD 70
              LG  GL+VSRLG G   L G Y   +  E   + ++   + GI   DT+DVYG D +
Sbjct: 1   YRTLGKTGLKVSRLGLGTWQLGGGY---VDEEEAAAAVRAALDAGINFIDTADVYG-DGE 56

Query: 71  NEIMVGKALKQLP-RDKIQLATKFGCFMLDGVSIGVKGSPEYVRKCCEASLKRLDVDYID 129
           +E ++G+ALK+   R+++ +ATK G    DG       SPE++R+  E SLKRL  DYID
Sbjct: 57  SEELLGEALKERGPREEVFIATKVGPRPGDGR----DLSPEHIRRAVEESLKRLGTDYID 112

Query: 130 LYYQHRVDTSV-SIEDTMGELKKLVEEGKIKYIGLSEASADTIRRAHAV--HPITAVQME 186
           LY  H  D     IE+T+  L++LV+EGKI+ IG+S  SA+ +  A A    P    Q+E
Sbjct: 113 LYLLHWPDPDTPDIEETLRALEELVKEGKIRAIGVSNFSAEQLEEALAAAGVPPAVNQVE 172

Query: 187 YSLWTREIEDDIIPLCRELGIGIVAYSPLGRGFFAGKAVVESLPSESILVCVTKQI 242
           Y+L  R+ E++++P CRE GIG++AYSPL  G   GK +  + P E  L+   K+I
Sbjct: 173 YNLLDRQAEEELLPYCREHGIGVIAYSPLAGGLLTGKYLPGAPPPEGDLLEALKEI 228

AKRs are present in all phyla and are of importance to both health and industrial applications. Members have very distinct functions and include the prokaryotic 2,5-diketo-D-gluconic acid reductases and beta-keto ester reductases, the eukaryotic aldose reductases, aldehyde reductases, hydroxysteroid dehydrogenases, steroid 5beta-reductases, potassium channel beta-subunits and aflatoxin aldehyde reductases, among others. Length = 285
>gnl|CDD|223739 COG0667, Tas, Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|215817 pfam00248, Aldo_ket_red, Aldo/keto reductase family Back     alignment and domain information
>gnl|CDD|223729 COG0656, ARA1, Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] Back     alignment and domain information
>gnl|CDD|178198 PLN02587, PLN02587, L-galactose dehydrogenase Back     alignment and domain information
>gnl|CDD|227322 COG4989, COG4989, Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>gnl|CDD|224370 COG1453, COG1453, Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] Back     alignment and domain information
>gnl|CDD|182140 PRK09912, PRK09912, L-glyceraldehyde 3-phosphate reductase; Provisional Back     alignment and domain information
>gnl|CDD|213602 TIGR01293, Kv_beta, voltage-dependent potassium channel beta subunit, animal Back     alignment and domain information
>gnl|CDD|236676 PRK10376, PRK10376, putative oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|236727 PRK10625, tas, putative aldo-keto reductase; Provisional Back     alignment and domain information
>gnl|CDD|183203 PRK11565, dkgA, 2,5-diketo-D-gluconate reductase A; Provisional Back     alignment and domain information
>gnl|CDD|183012 PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 242
COG0667316 Tas Predicted oxidoreductases (related to aryl-alc 100.0
KOG1575336 consensus Voltage-gated shaker-like K+ channel, su 100.0
COG0656280 ARA1 Aldo/keto reductases, related to diketogulona 100.0
PRK09912346 L-glyceraldehyde 3-phosphate reductase; Provisiona 100.0
TIGR01293317 Kv_beta voltage-dependent potassium channel beta s 100.0
PRK10625346 tas putative aldo-keto reductase; Provisional 100.0
cd06660285 Aldo_ket_red Aldo-keto reductases (AKRs) are a sup 100.0
KOG1577300 consensus Aldo/keto reductase family proteins [Gen 100.0
PLN02587314 L-galactose dehydrogenase 100.0
PRK10376290 putative oxidoreductase; Provisional 100.0
PF00248283 Aldo_ket_red: Aldo/keto reductase family; InterPro 100.0
PRK14863292 bifunctional regulator KidO; Provisional 100.0
PRK11172267 dkgB 2,5-diketo-D-gluconate reductase B; Provision 100.0
COG4989298 Predicted oxidoreductase [General function predict 100.0
KOG1576342 consensus Predicted oxidoreductase [Energy product 100.0
PRK11565275 dkgA 2,5-diketo-D-gluconate reductase A; Provision 100.0
COG1453 391 Predicted oxidoreductases of the aldo/keto reducta 100.0
KOG3023285 consensus Glutamate-cysteine ligase regulatory sub 98.42
cd03319316 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase cat 94.83
cd03316357 MR_like Mandelate racemase (MR)-like subfamily of 93.07
cd03315265 MLE_like Muconate lactonizing enzyme (MLE) like su 91.09
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 89.61
PRK00164331 moaA molybdenum cofactor biosynthesis protein A; R 88.75
PRK08392215 hypothetical protein; Provisional 88.37
cd03323395 D-glucarate_dehydratase D-Glucarate dehydratase (G 87.54
cd03174 265 DRE_TIM_metallolyase DRE-TIM metallolyase superfam 87.0
cd03318365 MLE Muconate Lactonizing Enzyme (MLE), an homoocta 86.47
TIGR02370197 pyl_corrinoid methyltransferase cognate corrinoid 85.6
cd03321355 mandelate_racemase Mandelate racemase (MR) catalyz 85.4
cd03322361 rpsA The starvation sensing protein RpsA from E.co 85.27
COG1140 513 NarY Nitrate reductase beta subunit [Energy produc 84.96
COG0135208 TrpF Phosphoribosylanthranilate isomerase [Amino a 84.65
TIGR02534368 mucon_cyclo muconate and chloromuconate cycloisome 84.52
PRK14017382 galactonate dehydratase; Provisional 83.76
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 83.65
PRK13958207 N-(5'-phosphoribosyl)anthranilate isomerase; Provi 83.2
cd00308229 enolase_like Enolase-superfamily, characterized by 82.93
PRK08609570 hypothetical protein; Provisional 82.92
PF05690247 ThiG: Thiazole biosynthesis protein ThiG; InterPro 82.81
PRK01222210 N-(5'-phosphoribosyl)anthranilate isomerase; Provi 82.28
PRK00208250 thiG thiazole synthase; Reviewed 81.71
COG3172187 NadR Predicted ATPase/kinase involved in NAD metab 80.93
cd03327341 MR_like_2 Mandelate racemase (MR)-like subfamily o 80.38
>COG0667 Tas Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] Back     alignment and domain information 
Probab=100.00  E-value=9e-54  Score=368.60  Aligned_cols=217  Identities=44%  Similarity=0.681  Sum_probs=196.2

Q ss_pred             CCeeecCCCCcccccceecccccCCcCCCCCCHHHHHHHHHHHHHcCCCEEeCccccCCCChhHHHHHHHHhcCC-CCCE
Q 026166            9 VPRVKLGSQGLEVSRLGFGCGGLSGIYNKPLSHEVGCSIIKETFNRGITLFDTSDVYGVDHDNEIMVGKALKQLP-RDKI   87 (242)
Q Consensus         9 m~~~~lg~~g~~vs~lglG~~~~~~~~~~~~~~~~~~~~l~~A~~~Gi~~~DtA~~Yg~~g~~e~~lg~~l~~~~-R~~l   87 (242)
                      |++++||++|+.||+||||||.+|+.+.. .+.+++.++|++|+++||||||||+.||. |.||+++|++|+... |+++
T Consensus         1 m~~r~lG~~gl~vs~lglG~~~~g~~~~~-~~~~~a~~il~~A~d~Gin~~DTA~~Yg~-g~sE~ilG~~l~~~~~Rd~v   78 (316)
T COG0667           1 MKYRRLGRSGLKVSPLGLGTMTLGGDTDD-EEEAEAIEILDAALDAGINFFDTADVYGD-GRSEEILGEALKERGRRDKV   78 (316)
T ss_pred             CCceecCCCCceecceeeeccccCCCCCc-hhhhHHHHHHHHHHHcCCCEEECccccCC-CchHHHHHHHHhccCCCCeE
Confidence            78999999999999999999999874222 25667888999999999999999999997 799999999999744 8999


Q ss_pred             EEEeecCcccCCCccc-CCCCCHHHHHHHHHHHHHHcCCCcccEEEeccCCCCCCHHHHHHHHHHHHHcCCcceEecCCC
Q 026166           88 QLATKFGCFMLDGVSI-GVKGSPEYVRKCCEASLKRLDVDYIDLYYQHRVDTSVSIEDTMGELKKLVEEGKIKYIGLSEA  166 (242)
Q Consensus        88 ~I~tK~~~~~~~~~~~-~~~~~~~~i~~~l~~sL~~L~~d~iDl~~lh~p~~~~~~~~~~~~l~~l~~~G~i~~iGvS~~  166 (242)
                      +|+||++....++... ....++++|+++++.||+|||+||||||++|+|++..+.++++++|.+|+++|+|++||+||+
T Consensus        79 vIaTK~g~~~~~~~~~~~~~~s~~~i~~~v~~SL~RLgtd~IDl~~iH~~d~~~p~~e~~~aL~~l~~~G~ir~iG~S~~  158 (316)
T COG0667          79 VIATKVGYRPGDPGPNGVFGLSRDHIRRAVEASLKRLGTDYIDLYQLHRPDPETPIEETLEALDELVREGKIRYIGVSNY  158 (316)
T ss_pred             EEEEeeccCCCCCCCCccCCCCHHHHHHHHHHHHHHhCCCceeEEEeCCCCCCCCHHHHHHHHHHHHHcCCeeEEEecCC
Confidence            9999998766421111 356899999999999999999999999999999999999999999999999999999999999


Q ss_pred             CHHHHHHHhcc-CCceEEecccCccCcChhhhHHHHHHHhCCcEEecccCccccCCCCCCCC
Q 026166          167 SADTIRRAHAV-HPITAVQMEYSLWTREIEDDIIPLCRELGIGIVAYSPLGRGFFAGKAVVE  227 (242)
Q Consensus       167 ~~~~l~~~~~~-~~~~~~q~~~~~~~~~~~~~l~~~~~~~gi~v~a~spl~~G~L~~~~~~~  227 (242)
                      +++++.++++. .+++++|.+||++++..+.+++++|+++||++++||||++|+|++++...
T Consensus       159 ~~~~i~~a~~~~~~~~~~Q~~ynl~~R~~e~~l~~~~~~~gi~~~~~spla~G~Ltgk~~~~  220 (316)
T COG0667         159 SAEQIAEALAVAAPIDSLQPEYNLLERDAEKELLPLCREEGIGLLAYSPLASGLLTGKYLPG  220 (316)
T ss_pred             CHHHHHHHHHhcCCceeecccCccccccchhHHHHHHHHcCCeEEEecCccccccCCCcCCC
Confidence            99999999999 59999999999999877777999999999999999999999999996653

>KOG1575 consensus Voltage-gated shaker-like K+ channel, subunit beta/KCNAB [Energy production and conversion] Back     alignment and domain information
>COG0656 ARA1 Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] Back     alignment and domain information
>PRK09912 L-glyceraldehyde 3-phosphate reductase; Provisional Back     alignment and domain information
>TIGR01293 Kv_beta voltage-dependent potassium channel beta subunit, animal Back     alignment and domain information
>PRK10625 tas putative aldo-keto reductase; Provisional Back     alignment and domain information
>cd06660 Aldo_ket_red Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols Back     alignment and domain information
>KOG1577 consensus Aldo/keto reductase family proteins [General function prediction only] Back     alignment and domain information
>PLN02587 L-galactose dehydrogenase Back     alignment and domain information
>PRK10376 putative oxidoreductase; Provisional Back     alignment and domain information
>PF00248 Aldo_ket_red: Aldo/keto reductase family; InterPro: IPR023210 The aldo-keto reductase family includes a number of related monomeric NADPH-dependent oxidoreductases, such as aldehyde reductase, aldose reductase, prostaglandin F synthase, xylose reductase, rho crystallin, and many others [] Back     alignment and domain information
>PRK14863 bifunctional regulator KidO; Provisional Back     alignment and domain information
>PRK11172 dkgB 2,5-diketo-D-gluconate reductase B; Provisional Back     alignment and domain information
>COG4989 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>KOG1576 consensus Predicted oxidoreductase [Energy production and conversion] Back     alignment and domain information
>PRK11565 dkgA 2,5-diketo-D-gluconate reductase A; Provisional Back     alignment and domain information
>COG1453 Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] Back     alignment and domain information
>KOG3023 consensus Glutamate-cysteine ligase regulatory subunit [Amino acid transport and metabolism] Back     alignment and domain information
>cd03319 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase catalyzes the epimerization of L-Ala-D/L-Glu and other dipeptides Back     alignment and domain information
>cd03316 MR_like Mandelate racemase (MR)-like subfamily of the enolase superfamily Back     alignment and domain information
>cd03315 MLE_like Muconate lactonizing enzyme (MLE) like subgroup of the enolase superfamily Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>PRK00164 moaA molybdenum cofactor biosynthesis protein A; Reviewed Back     alignment and domain information
>PRK08392 hypothetical protein; Provisional Back     alignment and domain information
>cd03323 D-glucarate_dehydratase D-Glucarate dehydratase (GlucD) catalyzes the dehydration of both D-glucarate and L-idarate to form 5-keto-4-deoxy-D-glucarate (5-KDG) , the initial reaction of the catabolic pathway for (D)-glucarate Back     alignment and domain information
>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily Back     alignment and domain information
>cd03318 MLE Muconate Lactonizing Enzyme (MLE), an homooctameric enzyme, catalyses the conversion of cis,cis-muconate (CCM) to muconolactone (ML) in the catechol branch of the beta-ketoadipate pathway Back     alignment and domain information
>TIGR02370 pyl_corrinoid methyltransferase cognate corrinoid proteins, Methanosarcina family Back     alignment and domain information
>cd03321 mandelate_racemase Mandelate racemase (MR) catalyzes the Mg2+-dependent 1,1-proton transfer reaction that interconverts the enantiomers of mandelic acid Back     alignment and domain information
>cd03322 rpsA The starvation sensing protein RpsA from E Back     alignment and domain information
>COG1140 NarY Nitrate reductase beta subunit [Energy production and conversion] Back     alignment and domain information
>COG0135 TrpF Phosphoribosylanthranilate isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02534 mucon_cyclo muconate and chloromuconate cycloisomerases Back     alignment and domain information
>PRK14017 galactonate dehydratase; Provisional Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13958 N-(5'-phosphoribosyl)anthranilate isomerase; Provisional Back     alignment and domain information
>cd00308 enolase_like Enolase-superfamily, characterized by the presence of an enolate anion intermediate which is generated by abstraction of the alpha-proton of the carboxylate substrate by an active site residue and is stabilized by coordination to the essential Mg2+ ion Back     alignment and domain information
>PRK08609 hypothetical protein; Provisional Back     alignment and domain information
>PF05690 ThiG: Thiazole biosynthesis protein ThiG; InterPro: IPR008867 This family consists of several bacterial thiazole biosynthesis protein G sequences Back     alignment and domain information
>PRK01222 N-(5'-phosphoribosyl)anthranilate isomerase; Provisional Back     alignment and domain information
>PRK00208 thiG thiazole synthase; Reviewed Back     alignment and domain information
>COG3172 NadR Predicted ATPase/kinase involved in NAD metabolism [Coenzyme metabolism] Back     alignment and domain information
>cd03327 MR_like_2 Mandelate racemase (MR)-like subfamily of the enolase superfamily, subgroup 2 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query242
3uyi_A 337 Crystal Structure Of Perakine Reductase, Founder Me 1e-95
3v0u_A 338 Crystal Structure Of Perakine Reductase, Founder Me 1e-95
3v0t_A 337 Crystal Structure Of Perakine Reductase, Founder Me 1e-94
3v0s_A 337 Crystal Structure Of Perakine Reductase, Founder Me 1e-91
1pyf_A312 Structure Of Nadph-Dependent Family 11 Aldo-Keto Re 2e-29
1pz1_A333 Structure Of Nadph-Dependent Family 11 Aldo-Keto Re 1e-26
3n2t_A348 Structure Of The Glycerol Dehydrogenase Akr11b4 Fro 1e-24
3erp_A353 Structure Of Idp01002, A Putative Oxidoreductase Fr 2e-24
1ynp_A317 Aldo-keto Reductase Akr11c1 From Bacillus Haloduran 8e-24
4aub_A366 The Complex Structure Of The Bacterial Aldo-Keto Re 3e-20
3n6q_A346 Crystal Structure Of Yghz From E. Coli Length = 346 3e-20
1qrq_A325 Structure Of A Voltage-Dependent K+ Channel Beta Su 3e-17
3eau_A327 Voltage-Dependent K+ Channel Beta Subunit In Comple 3e-17
2a79_A333 Mammalian Shaker Kv1.2 Potassium Channel- Beta Subu 3e-17
1zsx_A347 Crystal Structure Of Human Potassium Channel Kv Bet 3e-17
3eb4_A327 Voltage-Dependent K+ Channel Beta Subunit (I211r) I 3e-17
1exb_A332 Structure Of The Cytoplasmic Beta Subunit-T1 Assemb 3e-17
3lut_A367 A Structural Model For The Full-Length Shaker Potas 4e-17
3eb3_A327 Voltage-Dependent K+ Channel Beta Subunit (W121a) I 4e-17
2bp1_B 360 Structure Of The Aflatoxin Aldehyde Reductase In Co 3e-15
2c91_A 338 Mouse Succinic Semialdehyde Reductase, Akr7a5 Lengt 4e-14
2clp_A 347 Crystal Structure Of Human Aflatoxin B1 Aldehyde Re 8e-14
1gve_A 327 Aflatoxin Aldehyde Reductase (Akr7a1) From Rat Live 8e-13
1lqa_A346 Tas Protein From Escherichia Coli In Complex With N 4e-12
3o0k_A283 Crystal Structure Of AldoKETO REDUCTASE FROM BRUCEL 4e-11
3krb_A334 Structure Of Aldose Reductase From Giardia Lamblia 1e-10
2bgq_A344 Apo Aldose Reductase From Barley Length = 344 2e-10
1og6_A298 Ydhf, An Aldo-keto Reductase From E.coli Complexed 2e-10
3up8_A298 Crystal Structure Of A Putative 2,5-Diketo-D-Glucon 1e-09
1ur3_M319 Crystal Structure Of The Apo Form Of The E.Coli Ydh 2e-09
4gac_A324 High Resolution Structure Of Mouse Aldehyde Reducta 6e-09
3cv7_A325 Crystal Structure Of Porcine Aldehyde Reductase Ter 7e-09
1cwn_A324 Crystal Structure Of Porcine Aldehyde Reductase Hol 8e-09
1ae4_A325 Aldehyde Reductase Complexed With Cofactor And Inhi 8e-09
1qwk_A317 Structural Genomics Of Caenorhabditis Elegans: Hypo 1e-08
1hqt_A326 The Crystal Structure Of An Aldehyde Reductase Y50f 2e-08
4f40_A288 X-Ray Crystal Structure Of Apo Prostaglandin F Synt 7e-08
1jez_A322 The Structure Of Xylose Reductase, A Dimeric Aldo-K 8e-08
1z9a_A321 Crystal Structure Of The Asn-309 To Asp Mutant Of C 8e-08
1ye4_A322 Crystal Structure Of The Lys-274 To Arg Mutant Of C 9e-08
1sm9_A322 Crystal Structure Of An Engineered K274rn276d Doubl 9e-08
2alr_A324 Aldehyde Reductase Length = 324 1e-07
2wzm_A283 Crystal Structure Of A Mycobacterium Aldo-Keto Redu 2e-07
1r38_A322 Crystal Structure Of H114a Mutant Of Candida Tenuis 2e-07
3h7r_A331 Crystal Structure Of The Plant Stress-Response Enzy 1e-06
4fzi_A290 Crystal Structure Of Prostaglandin F Synthase From 1e-06
1vp5_A298 Crystal Structure Of 2,5-diketo-d-gluconic Acid Red 2e-06
3h7u_A335 Crystal Structure Of The Plant Stress-Response Enzy 3e-06
1vbj_A281 The Crystal Structure Of Prostaglandin F Synthase F 2e-05
4exa_A292 Crystal Structure Of The Pa4992, The Putative Aldo- 3e-05
1zua_X317 Crystal Structure Of Akr1b10 Complexed With Nadp+ A 7e-05
1mzr_A296 Structure Of Dkga From E.Coli At 2.13 A Resolution 3e-04
3uzw_A346 Crystal Structure Of 5beta-Reductase (Akr1d1) E120h 8e-04
>pdb|3UYI|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 Back     alignment and structure 
Iteration: 1

 Score =  345 bits (886), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 163/229 (71%), Positives = 192/229 (83%)
Query: 8   HVPRVKLGSQGLEVSRLGFGCGGLSGIYNKPLSHEVGCSIIKETFNRGITLFDTSDVYGV 67
           H+PRVKLG+QGLEVS+LGFGC GLSG YN  L  E G ++IKE FN GIT FDTSD+YG 
Sbjct: 1   HMPRVKLGTQGLEVSKLGFGCMGLSGDYNDALPEEQGIAVIKEAFNCGITFFDTSDIYGE 60
Query: 68  DHDNEIMVGKALKQLPRDKIQLATKFGCFMLDGVSIGVKGSPEYVRKCCEASLKRLDVDY 127
           +  NE ++GKALKQLPR+KIQ+ TKFG   +    +  KG+P+YVR CCEASLKRLDVDY
Sbjct: 61  NGSNEELLGKALKQLPREKIQVGTKFGIHEIGFSGVKAKGTPDYVRSCCEASLKRLDVDY 120
Query: 128 IDLYYQHRVDTSVSIEDTMGELKKLVEEGKIKYIGLSEASADTIRRAHAVHPITAVQMEY 187
           IDL+Y HR+DT+V IE TMGEL KLVEEGKIKY+GLSEAS DTIRRAHAVHP+TA+Q+EY
Sbjct: 121 IDLFYIHRIDTTVPIEITMGELXKLVEEGKIKYVGLSEASPDTIRRAHAVHPVTALQIEY 180
Query: 188 SLWTREIEDDIIPLCRELGIGIVAYSPLGRGFFAGKAVVESLPSESILV 236
           SLWTR+IED+I+PLCR+LGIGIV YSP+GRG FAGKA+ ESLP  S+L 
Sbjct: 181 SLWTRDIEDEIVPLCRQLGIGIVPYSPIGRGLFAGKAIKESLPENSVLT 229
>pdb|3V0U|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 338 Back     alignment and structure
>pdb|3V0T|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 Back     alignment and structure
>pdb|3V0S|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 Back     alignment and structure
>pdb|1PYF|A Chain A, Structure Of Nadph-Dependent Family 11 Aldo-Keto Reductase Akr11a(Apo) Length = 312 Back     alignment and structure
>pdb|1PZ1|A Chain A, Structure Of Nadph-Dependent Family 11 Aldo-Keto Reductase Akr11b(Holo) Length = 333 Back     alignment and structure
>pdb|3N2T|A Chain A, Structure Of The Glycerol Dehydrogenase Akr11b4 From Gluconobacter Oxydans Length = 348 Back     alignment and structure
>pdb|3ERP|A Chain A, Structure Of Idp01002, A Putative Oxidoreductase From And Essential Gene Of Salmonella Typhimurium Length = 353 Back     alignment and structure
>pdb|1YNP|A Chain A, Aldo-keto Reductase Akr11c1 From Bacillus Halodurans (apo Form) Length = 317 Back     alignment and structure
>pdb|4AUB|A Chain A, The Complex Structure Of The Bacterial Aldo-Keto Reductase Akr14a1 With Nadp And Citrate Length = 366 Back     alignment and structure
>pdb|3N6Q|A Chain A, Crystal Structure Of Yghz From E. Coli Length = 346 Back     alignment and structure
>pdb|1QRQ|A Chain A, Structure Of A Voltage-Dependent K+ Channel Beta Subunit Length = 325 Back     alignment and structure
>pdb|3EAU|A Chain A, Voltage-Dependent K+ Channel Beta Subunit In Complex With Cortisone Length = 327 Back     alignment and structure
>pdb|2A79|A Chain A, Mammalian Shaker Kv1.2 Potassium Channel- Beta Subunit Complex Length = 333 Back     alignment and structure
>pdb|1ZSX|A Chain A, Crystal Structure Of Human Potassium Channel Kv Beta-Subunit (Kcnab2) Length = 347 Back     alignment and structure
>pdb|3EB4|A Chain A, Voltage-Dependent K+ Channel Beta Subunit (I211r) In Complex With Cortisone Length = 327 Back     alignment and structure
>pdb|1EXB|A Chain A, Structure Of The Cytoplasmic Beta Subunit-T1 Assembly Of Voltage-Dependent K Channels Length = 332 Back     alignment and structure
>pdb|3LUT|A Chain A, A Structural Model For The Full-Length Shaker Potassium Channel Kv1.2 Length = 367 Back     alignment and structure
>pdb|3EB3|A Chain A, Voltage-Dependent K+ Channel Beta Subunit (W121a) In Complex With Cortisone Length = 327 Back     alignment and structure
>pdb|2C91|A Chain A, Mouse Succinic Semialdehyde Reductase, Akr7a5 Length = 338 Back     alignment and structure
>pdb|2CLP|A Chain A, Crystal Structure Of Human Aflatoxin B1 Aldehyde Reductase Member 3 Length = 347 Back     alignment and structure
>pdb|1GVE|A Chain A, Aflatoxin Aldehyde Reductase (Akr7a1) From Rat Liver Length = 327 Back     alignment and structure
>pdb|1LQA|A Chain A, Tas Protein From Escherichia Coli In Complex With Nadph Length = 346 Back     alignment and structure
>pdb|3O0K|A Chain A, Crystal Structure Of AldoKETO REDUCTASE FROM BRUCELLA MELITENSIS Length = 283 Back     alignment and structure
>pdb|3KRB|A Chain A, Structure Of Aldose Reductase From Giardia Lamblia At 1.75a Resolution Length = 334 Back     alignment and structure
>pdb|2BGQ|A Chain A, Apo Aldose Reductase From Barley Length = 344 Back     alignment and structure
>pdb|1OG6|A Chain A, Ydhf, An Aldo-keto Reductase From E.coli Complexed With Nadph Length = 298 Back     alignment and structure
>pdb|3UP8|A Chain A, Crystal Structure Of A Putative 2,5-Diketo-D-Gluconic Acid Reductase B Length = 298 Back     alignment and structure
>pdb|1UR3|M Chain M, Crystal Structure Of The Apo Form Of The E.Coli Ydhf Protein Length = 319 Back     alignment and structure
>pdb|4GAC|A Chain A, High Resolution Structure Of Mouse Aldehyde Reductase (akr1a4) In Its Apo-form Length = 324 Back     alignment and structure
>pdb|3CV7|A Chain A, Crystal Structure Of Porcine Aldehyde Reductase Ternary Complex Length = 325 Back     alignment and structure
>pdb|1CWN|A Chain A, Crystal Structure Of Porcine Aldehyde Reductase Holoenzyme Length = 324 Back     alignment and structure
>pdb|1AE4|A Chain A, Aldehyde Reductase Complexed With Cofactor And Inhibitor, Alpha Carbon Atoms Only Length = 325 Back     alignment and structure
>pdb|1QWK|A Chain A, Structural Genomics Of Caenorhabditis Elegans: Hypothetical 35.2 Kda Protein (Aldose Reductase Family Member) Length = 317 Back     alignment and structure
>pdb|1HQT|A Chain A, The Crystal Structure Of An Aldehyde Reductase Y50f Mutant- Nadp Complex And Its Implications For Substrate Binding Length = 326 Back     alignment and structure
>pdb|4F40|A Chain A, X-Ray Crystal Structure Of Apo Prostaglandin F Synthase From Leishmania Major Friedlin Length = 288 Back     alignment and structure
>pdb|1JEZ|A Chain A, The Structure Of Xylose Reductase, A Dimeric Aldo-Keto Reductase From Candida Tenuis Length = 322 Back     alignment and structure
>pdb|1Z9A|A Chain A, Crystal Structure Of The Asn-309 To Asp Mutant Of Candida Tenuis Xylose Reductase (Akr2b5) Bound To Nad+ Length = 321 Back     alignment and structure
>pdb|1YE4|A Chain A, Crystal Structure Of The Lys-274 To Arg Mutant Of Candida Tenuis Xylose Reductase (Akr2b5) Bound To Nad+ Length = 322 Back     alignment and structure
>pdb|1SM9|A Chain A, Crystal Structure Of An Engineered K274rn276d Double Mutant Of Xylose Reductase From Candida Tenuis Optimized To Utilize Nad Length = 322 Back     alignment and structure
>pdb|2ALR|A Chain A, Aldehyde Reductase Length = 324 Back     alignment and structure
>pdb|2WZM|A Chain A, Crystal Structure Of A Mycobacterium Aldo-Keto Reductase In Its Apo And Liganded Form Length = 283 Back     alignment and structure
>pdb|1R38|A Chain A, Crystal Structure Of H114a Mutant Of Candida Tenuis Xylose Reductase Length = 322 Back     alignment and structure
>pdb|3H7R|A Chain A, Crystal Structure Of The Plant Stress-Response Enzyme Akr4c8 Length = 331 Back     alignment and structure
>pdb|4FZI|A Chain A, Crystal Structure Of Prostaglandin F Synthase From Trypanosoma Cruzi Length = 290 Back     alignment and structure
>pdb|1VP5|A Chain A, Crystal Structure Of 2,5-diketo-d-gluconic Acid Reductase (tm1009) From Thermotoga Maritima At 2.40 A Resolution Length = 298 Back     alignment and structure
>pdb|3H7U|A Chain A, Crystal Structure Of The Plant Stress-Response Enzyme Akr4c9 Length = 335 Back     alignment and structure
>pdb|1VBJ|A Chain A, The Crystal Structure Of Prostaglandin F Synthase From Trypanosoma Brucei Length = 281 Back     alignment and structure
>pdb|4EXA|A Chain A, Crystal Structure Of The Pa4992, The Putative Aldo-keto Reductase From Pseudomona Aeruginosa Length = 292 Back     alignment and structure
>pdb|1ZUA|X Chain X, Crystal Structure Of Akr1b10 Complexed With Nadp+ And Tolrestat Length = 317 Back     alignment and structure
>pdb|1MZR|A Chain A, Structure Of Dkga From E.Coli At 2.13 A Resolution Solved By Molecular Replacement Length = 296 Back     alignment and structure
>pdb|3UZW|A Chain A, Crystal Structure Of 5beta-Reductase (Akr1d1) E120h Mutant In Complex With Nadp+ Length = 346 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query242
1pyf_A312 IOLS protein; beta-alpha barrel, aldo-keto reducta 1e-130
3n2t_A348 Putative oxidoreductase; aldo/keto reductase super 1e-128
1pz1_A333 GSP69, general stress protein 69; beta-alpha barre 1e-116
3v0s_A 337 Perakine reductase; AKR superfamily, oxidoreductas 1e-106
1ynp_A317 Oxidoreductase, AKR11C1; aldo-keto reductase, NADP 1e-103
1ur3_M319 Hypothetical oxidoreductase YDHF; NADP binding, al 6e-94
2bp1_A 360 Aflatoxin B1 aldehyde reductase member 2; oxidored 4e-67
1gve_A 327 Aflatoxin B1 aldehyde reductase member 3; oxidored 1e-65
3erp_A353 Putative oxidoreductase; funded by the national in 3e-63
3n6q_A346 YGHZ aldo-keto reductase; TIM barrel, oxidoreducta 9e-60
3eau_A327 Voltage-gated potassium channel subunit beta-2; kv 6e-57
3lut_A367 Voltage-gated potassium channel subunit beta-2; vo 1e-56
1lqa_A346 TAS protein; TIM barrel, structure 2 function proj 1e-50
1qwk_A317 Aldose reductase, aldo-keto reductase family 1 mem 8e-25
3up8_A298 Putative 2,5-diketo-D-gluconic acid reductase B; n 2e-24
3buv_A326 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc 9e-24
1s1p_A331 Aldo-keto reductase family 1 member C3; TIM-barrel 2e-23
1zgd_A312 Chalcone reductase; polyketide, deoxychalcone, iso 6e-23
1afs_A323 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; 7e-23
1mi3_A322 Xylose reductase, XR; aldo-keto reductase, beta-al 8e-23
2ao0_A324 Aldehyde dehydrogenase; TIM barrel, aldo-keto redu 1e-22
2bgs_A344 Aldose reductase; holoenzyme, aldo/keto reductase, 1e-22
2wzm_A283 Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 2e-22
3h7r_A331 Aldo-keto reductase; stress response, NADP, drough 2e-22
3krb_A334 Aldose reductase; ssgcid, SBRI, emerald biostructu 3e-22
1us0_A316 Aldose reductase; oxidoreductase, NADP, IDD594; HE 3e-22
3o3r_A316 Aldo-keto reductase family 1, member B7; aldose re 9e-22
4f40_A288 Prostaglandin F2-alpha synthase/D-arabinose dehyd; 1e-21
3h7u_A335 Aldo-keto reductase; stress response, NADP, drough 1e-21
3o0k_A283 Aldo/keto reductase; ssgcid, ALS collaborative cry 2e-21
1hw6_A278 2,5-diketo-D-gluconic acid reductase; aldo-keto re 2e-21
1vbj_A281 Prostaglandin F synthase; TIM barrel, oxidoreducta 8e-21
1mzr_A296 2,5-diketo-D-gluconate reductase A; alpha/beta-bar 2e-20
4gie_A290 Prostaglandin F synthase; structural genomics, nia 2e-20
1vp5_A298 2,5-diketo-D-gluconic acid reductase; TM1009, stru 9e-20
3f7j_A276 YVGN protein; aldo-keto reductase, oxidoreductase; 1e-19
3b3e_A310 YVGN protein; aldo-keto reductase, oxidoreductase; 1e-19
3ln3_A324 Dihydrodiol dehydrogenase; putative reductase, str 3e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
>1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* Length = 312 Back     alignment and structure
 Score =  369 bits (951), Expect = e-130
 Identities = 68/214 (31%), Positives = 113/214 (52%), Gaps = 3/214 (1%)

Query: 11  RVKLGSQGLEVSRLGFGCGGLSG-IYNKPLSHEVGCSIIKETFNRGITLFDTSDVYGVDH 69
           + KLG   L+V  +G G   + G      L+ E G  +++E    G+T+ DT+ +YG   
Sbjct: 3   KAKLGKSDLQVFPIGLGTNAVGGHNLYPNLNEETGKELVREAIRNGVTMLDTAYIYG-IG 61

Query: 70  DNEIMVGKALKQLPRDKIQLATKFGCFMLDGVSIGVKGSPEYVRKCCEASLKRLDVDYID 129
            +E ++G+ L++  R+ + +ATK       G       SP++++K  + SLKRL+ DYID
Sbjct: 62  RSEELIGEVLREFNREDVVIATKAA-HRKQGNDFVFDNSPDFLKKSVDESLKRLNTDYID 120

Query: 130 LYYQHRVDTSVSIEDTMGELKKLVEEGKIKYIGLSEASADTIRRAHAVHPITAVQMEYSL 189
           L+Y H  D     ++ +  L ++ + GKI+ IG+S  S + ++ A+    +  +Q EY+L
Sbjct: 121 LFYIHFPDEHTPKDEAVNALNEMKKAGKIRSIGVSNFSLEQLKEANKDGLVDVLQGEYNL 180

Query: 190 WTREIEDDIIPLCRELGIGIVAYSPLGRGFFAGK 223
             RE E    P  +E  I  + Y PL  G  AGK
Sbjct: 181 LNREAEKTFFPYTKEHNISFIPYFPLVSGLLAGK 214
>3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} Length = 348 Back     alignment and structure
>1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 Length = 333 Back     alignment and structure
>3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* Length = 337 Back     alignment and structure
>1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* Length = 317 Back     alignment and structure
>1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* Length = 319 Back     alignment and structure
>1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* Length = 327 Back     alignment and structure
>3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} Length = 353 Back     alignment and structure
>3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} Length = 346 Back     alignment and structure
>3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* Length = 327 Back     alignment and structure
>3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} Length = 367 Back     alignment and structure
>1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 Length = 346 Back     alignment and structure
>1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 Length = 317 Back     alignment and structure
>3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} Length = 298 Back     alignment and structure
>3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* Length = 326 Back     alignment and structure
>1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... Length = 331 Back     alignment and structure
>1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} Length = 312 Back     alignment and structure
>1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* Length = 323 Back     alignment and structure
>1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* Length = 322 Back     alignment and structure
>2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* Length = 344 Back     alignment and structure
>2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A Length = 283 Back     alignment and structure
>3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} Length = 331 Back     alignment and structure
>3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} Length = 334 Back     alignment and structure
>1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... Length = 316 Back     alignment and structure
>3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} PDB: 3qkz_A* Length = 316 Back     alignment and structure
>4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} Length = 288 Back     alignment and structure
>3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} Length = 335 Back     alignment and structure
>3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} Length = 283 Back     alignment and structure
>1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* Length = 278 Back     alignment and structure
>1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} Length = 281 Back     alignment and structure
>1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 Length = 296 Back     alignment and structure
>4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* Length = 290 Back     alignment and structure
>1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 Length = 298 Back     alignment and structure
>3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* Length = 276 Back     alignment and structure
>3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} Length = 324 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query242
3v0s_A 337 Perakine reductase; AKR superfamily, oxidoreductas 100.0
1pyf_A312 IOLS protein; beta-alpha barrel, aldo-keto reducta 100.0
3n2t_A348 Putative oxidoreductase; aldo/keto reductase super 100.0
1pz1_A333 GSP69, general stress protein 69; beta-alpha barre 100.0
3n6q_A346 YGHZ aldo-keto reductase; TIM barrel, oxidoreducta 100.0
1ynp_A317 Oxidoreductase, AKR11C1; aldo-keto reductase, NADP 100.0
3eau_A327 Voltage-gated potassium channel subunit beta-2; kv 100.0
3erp_A353 Putative oxidoreductase; funded by the national in 100.0
4exb_A292 Putative uncharacterized protein; aldo-keto reduct 100.0
3lut_A367 Voltage-gated potassium channel subunit beta-2; vo 100.0
1lqa_A346 TAS protein; TIM barrel, structure 2 function proj 100.0
1ur3_M319 Hypothetical oxidoreductase YDHF; NADP binding, al 100.0
3o0k_A283 Aldo/keto reductase; ssgcid, ALS collaborative cry 100.0
3f7j_A276 YVGN protein; aldo-keto reductase, oxidoreductase; 100.0
3ln3_A324 Dihydrodiol dehydrogenase; putative reductase, str 100.0
3up8_A298 Putative 2,5-diketo-D-gluconic acid reductase B; n 100.0
3b3e_A310 YVGN protein; aldo-keto reductase, oxidoreductase; 100.0
1vbj_A281 Prostaglandin F synthase; TIM barrel, oxidoreducta 100.0
2wzm_A283 Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 100.0
4f40_A288 Prostaglandin F2-alpha synthase/D-arabinose dehyd; 100.0
1hw6_A278 2,5-diketo-D-gluconic acid reductase; aldo-keto re 100.0
1afs_A323 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; 100.0
1zgd_A312 Chalcone reductase; polyketide, deoxychalcone, iso 100.0
3buv_A326 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc 100.0
4gie_A290 Prostaglandin F synthase; structural genomics, nia 100.0
1mi3_A322 Xylose reductase, XR; aldo-keto reductase, beta-al 100.0
2bp1_A 360 Aflatoxin B1 aldehyde reductase member 2; oxidored 100.0
1qwk_A317 Aldose reductase, aldo-keto reductase family 1 mem 100.0
1s1p_A331 Aldo-keto reductase family 1 member C3; TIM-barrel 100.0
1gve_A 327 Aflatoxin B1 aldehyde reductase member 3; oxidored 100.0
3o3r_A316 Aldo-keto reductase family 1, member B7; aldose re 100.0
3h7u_A335 Aldo-keto reductase; stress response, NADP, drough 100.0
1us0_A316 Aldose reductase; oxidoreductase, NADP, IDD594; HE 100.0
1mzr_A296 2,5-diketo-D-gluconate reductase A; alpha/beta-bar 100.0
1vp5_A298 2,5-diketo-D-gluconic acid reductase; TM1009, stru 100.0
3krb_A334 Aldose reductase; ssgcid, SBRI, emerald biostructu 100.0
3b3d_A314 YTBE protein, putative morphine dehydrogenase; ald 100.0
3h7r_A331 Aldo-keto reductase; stress response, NADP, drough 100.0
2bgs_A344 Aldose reductase; holoenzyme, aldo/keto reductase, 100.0
4gac_A324 Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldhe 100.0
3cf4_A 807 Acetyl-COA decarboxylase/synthase alpha subunit; m 97.74
3jva_A354 Dipeptide epimerase; enolase superfamily, isomeras 93.31
2poz_A392 Putative dehydratase; octamer, structural genomics 93.26
3eez_A378 Putative mandelate racemase/muconate lactonizing e 93.14
3i4k_A383 Muconate lactonizing enzyme; structural genomics, 93.13
3q45_A368 Mandelate racemase/muconate lactonizing enzyme FA 92.82
2rdx_A379 Mandelate racemase/muconate lactonizing enzyme, P; 92.42
1nu5_A370 Chloromuconate cycloisomerase; enzyme, dehalogenat 92.39
1mdl_A359 Mandelate racemase; isomerase, mandelate pathway, 92.33
3gd6_A391 Muconate cycloisomerase; structural genomics, NYSG 92.3
2o56_A407 Putative mandelate racemase; dehydratase, structur 92.22
3fv9_G386 Mandelate racemase/muconate lactonizing enzyme; st 92.16
3r0u_A379 Enzyme of enolase superfamily; structural genomics 92.14
1tkk_A366 Similar to chloromuconate cycloisomerase; epimeras 92.04
2nql_A388 AGR_PAT_674P, isomerase/lactonizing enzyme; enolas 91.81
3tj4_A372 Mandelate racemase; enolase, dehydratase, enzyme f 91.62
2ovl_A371 Putative racemase; structural genomics, PSI-2, pro 91.54
3i6e_A385 Muconate cycloisomerase I; structural genomics, NY 91.52
3ik4_A365 Mandelate racemase/muconate lactonizing protein; s 91.45
3dg3_A367 Muconate cycloisomerase; muconate lactonizing enzy 91.42
3mwc_A400 Mandelate racemase/muconate lactonizing protein; e 91.21
2pgw_A384 Muconate cycloisomerase; enolase superfamily, octa 91.07
3ozy_A389 Putative mandelate racemase; beta-alpha barrel, en 91.02
2qdd_A378 Mandelate racemase/muconate lactonizing enzyme; en 90.97
2zad_A345 Muconate cycloisomerase; muconate lactonizing enzy 90.79
1r0m_A375 N-acylamino acid racemase; isomerase; 1.30A {Deino 90.72
4e8g_A391 Enolase, mandelate racemase/muconate lactonizing e 90.65
2ps2_A371 Putative mandelate racemase/muconate lactonizing e 90.5
2og9_A393 Mandelate racemase/muconate lactonizing enzyme; NY 90.49
2p8b_A369 Mandelate racemase/muconate lactonizing enzyme fam 90.37
3ro6_B356 Putative chloromuconate cycloisomerase; TIM barrel 90.17
2qde_A397 Mandelate racemase/muconate lactonizing enzyme FA 89.58
2pp0_A398 L-talarate/galactarate dehydratase; enolase superf 89.57
2ox4_A403 Putative mandelate racemase; enolase, dehydratase, 89.47
4dwd_A393 Mandelate racemase/muconate lactonizing enzyme, C 89.41
3qld_A388 Mandelate racemase/muconate lactonizing protein; s 89.22
2qgy_A391 Enolase from the environmental genome shotgun sequ 88.66
3s5s_A389 Mandelate racemase/muconate lactonizing enzyme FA 88.65
2hzg_A401 Mandelate racemase/muconate lactonizing enzyme/EN 88.4
2zc8_A369 N-acylamino acid racemase; octamer, TIM beta/alpha 88.29
4h1z_A412 Enolase Q92ZS5; dehydratase, magnesium binding sit 88.27
2gl5_A410 Putative dehydratase protein; structural genomics, 88.04
1sjd_A368 N-acylamino acid racemase; lyase, isomerase; HET: 88.0
2qq6_A410 Mandelate racemase/muconate lactonizing enzyme- li 87.68
2chr_A370 Chloromuconate cycloisomerase; 3.00A {Cupriavidus 86.97
3bjs_A428 Mandelate racemase/muconate lactonizing enzyme; en 86.96
1tzz_A392 Hypothetical protein L1841; structural genomics, m 86.92
3rr1_A405 GALD, putative D-galactonate dehydratase; enolase, 86.91
1rvk_A382 Isomerase/lactonizing enzyme; enolase superfamily, 86.82
1wuf_A393 Hypothetical protein LIN2664; structural genomics, 86.59
3stp_A412 Galactonate dehydratase, putative; PSI biology, st 86.57
3my9_A377 Muconate cycloisomerase; structural genomics, PSI- 86.43
4dye_A398 Isomerase; enolase family protein, EFI, enzym func 86.36
3fcp_A381 L-Ala-D/L-Glu epimerase, A muconate lactonizing en 85.98
3ddm_A392 Putative mandelate racemase/muconate lactonizing e 85.84
3toy_A383 Mandelate racemase/muconate lactonizing enzyme FA 84.96
3sjn_A374 Mandelate racemase/muconate lactonizing protein; e 84.33
1chr_A370 Chloromuconate cycloisomerase; 3.00A {Ralstonia eu 84.08
2gdq_A382 YITF; mandelate racemase/muconate lactonizing enzy 84.05
3u9i_A393 Mandelate racemase/muconate lactonizing enzyme, C 83.47
4a35_A441 Mitochondrial enolase superfamily member 1; isomer 83.4
3va8_A445 Probable dehydratase; enolase, magnesium binding s 83.22
2ozt_A332 TLR1174 protein; structural genomics, O-succinylbe 83.01
4e5t_A404 Mandelate racemase / muconate lactonizing enzyme, 82.32
2hxt_A441 L-fuconate dehydratase; enolase superfamily, D-ery 82.23
3vdg_A445 Probable glucarate dehydratase; enolase, magnesium 82.08
3dgb_A382 Muconate cycloisomerase; muconate lactonizing enzy 82.06
2oz8_A389 MLL7089 protein; structural genomics, unknown func 81.59
3r4e_A418 Mandelate racemase/muconate lactonizing enzyme; en 80.91
4h83_A388 Mandelate racemase/muconate lactonizing enzyme; st 80.17
4hnl_A421 Mandelate racemase/muconate lactonizing enzyme; de 80.05
>3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* Back     alignment and structure
Probab=100.00  E-value=1.4e-56  Score=389.84  Aligned_cols=215  Identities=70%  Similarity=1.170  Sum_probs=192.5

Q ss_pred             CCeeecCCCCcccccceecccccCCcCCCCCCHHHHHHHHHHHHHcCCCEEeCccccCCCChhHHHHHHHHhcCCCCCEE
Q 026166            9 VPRVKLGSQGLEVSRLGFGCGGLSGIYNKPLSHEVGCSIIKETFNRGITLFDTSDVYGVDHDNEIMVGKALKQLPRDKIQ   88 (242)
Q Consensus         9 m~~~~lg~~g~~vs~lglG~~~~~~~~~~~~~~~~~~~~l~~A~~~Gi~~~DtA~~Yg~~g~~e~~lg~~l~~~~R~~l~   88 (242)
                      |+|++||++|+.||+||||||++|+.|+...+.+++.++|++|++.|||+||||+.||.+|.||+.+|++|++.+|+++|
T Consensus         1 M~~~~lg~tg~~vs~lglGt~~~g~~~~~~~~~~~~~~~l~~Al~~Gi~~~DTA~~Yg~~G~sE~~lG~al~~~~R~~~~   80 (337)
T 3v0s_A            1 MPRVKLGTQGLEVSKLGFGCMGLSGDYNDALPEEQGIAVIKEAFNCGITFFDTSDIYGENGSNEELLGKALKQLPREXIQ   80 (337)
T ss_dssp             CCEEECSSSSCEEESSCEECGGGC-------CHHHHHHHHHHHHHTTCCEEECCTTSSSTTHHHHHHHHHHTTSCGGGCE
T ss_pred             CCeeecCCCCceecCeeecccccCCCCCCCCCHHHHHHHHHHHHHcCCCEEEChhhhCCCCcHHHHHHHHHhhcCCcceE
Confidence            89999999999999999999999887876568899999999999999999999999996568999999999866899999


Q ss_pred             EEeecCcccCCCcccCCCCCHHHHHHHHHHHHHHcCCCcccEEEeccCCCCCCHHHHHHHHHHHHHcCCcceEecCCCCH
Q 026166           89 LATKFGCFMLDGVSIGVKGSPEYVRKCCEASLKRLDVDYIDLYYQHRVDTSVSIEDTMGELKKLVEEGKIKYIGLSEASA  168 (242)
Q Consensus        89 I~tK~~~~~~~~~~~~~~~~~~~i~~~l~~sL~~L~~d~iDl~~lh~p~~~~~~~~~~~~l~~l~~~G~i~~iGvS~~~~  168 (242)
                      |+||++......+....+.+++.+++++++||++||+||||+|++|||+...+.+++|++|++|+++||||+||||||++
T Consensus        81 i~TK~~~~~~~~~~~~~~~~~~~i~~~~~~SL~rLg~dyiDl~~lH~p~~~~~~~e~~~al~~l~~~Gkir~iGvSn~~~  160 (337)
T 3v0s_A           81 VGTKFGIHEIGFSGVKAXGTPDYVRSCCEASLKRLDVDYIDLFYIHRIDTTVPIEITMGELXXLVEEGKIXYVGLSEASP  160 (337)
T ss_dssp             EEEEECEEEEETTEEEECCCHHHHHHHHHHHHHHHTCSCEEEEEESSCCTTSCHHHHHHHHHHHHHTTSEEEEEEESCCH
T ss_pred             EEeeeccccCCCCcccCCCCHHHHHHHHHHHHHHhCCCCeeEEEecCCCCCCCHHHHHHHHHHHHHCCCeeEEeccCCCH
Confidence            99999875422122233578999999999999999999999999999999889999999999999999999999999999


Q ss_pred             HHHHHHhccCCceEEecccCccCcChhhhHHHHHHHhCCcEEecccCccccCCCC
Q 026166          169 DTIRRAHAVHPITAVQMEYSLWTREIEDDIIPLCRELGIGIVAYSPLGRGFFAGK  223 (242)
Q Consensus       169 ~~l~~~~~~~~~~~~q~~~~~~~~~~~~~l~~~~~~~gi~v~a~spl~~G~L~~~  223 (242)
                      ++++++++..+++++|++||++++..+.+++++|+++||.+++||||++|+|+++
T Consensus       161 ~~l~~~~~~~~~~~~Q~~~~~~~~~~e~~l~~~~~~~gi~v~a~spL~~G~L~g~  215 (337)
T 3v0s_A          161 DTIRRAHAVHPVTALQIEYSLWTRDIEDEIVPLCRQLGIGIVPYSPIGRGLFWGK  215 (337)
T ss_dssp             HHHHHHHHHSCCCEEEEECBTTBCGGGTTHHHHHHHHTCEEEEESTTHHHHHHHH
T ss_pred             HHHHHHhccCCceEEEeeccccccchhHHHHHHHHHcCceEEEeccccCcccCCC
Confidence            9999999999999999999999998777899999999999999999999999876
>1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* Back     alignment and structure
>3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} SCOP: c.1.7.0 Back     alignment and structure
>1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 Back     alignment and structure
>3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} SCOP: c.1.7.0 PDB: 4ast_A 4aub_A* Back     alignment and structure
>1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* Back     alignment and structure
>3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* Back     alignment and structure
>3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} Back     alignment and structure
>4exb_A Putative uncharacterized protein; aldo-keto reductase, NADP+ binding, oxidoreducta; 2.75A {Pseudomonas aeruginosa} PDB: 4exa_A Back     alignment and structure
>3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} Back     alignment and structure
>1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 Back     alignment and structure
>1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* Back     alignment and structure
>3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} Back     alignment and structure
>3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* Back     alignment and structure
>3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} SCOP: c.1.7.1 Back     alignment and structure
>3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} Back     alignment and structure
>1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} Back     alignment and structure
>2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A Back     alignment and structure
>4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} PDB: 4g5d_A* Back     alignment and structure
>1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* Back     alignment and structure
>1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* Back     alignment and structure
>1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} Back     alignment and structure
>3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* Back     alignment and structure
>4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* Back     alignment and structure
>1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* Back     alignment and structure
>1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 Back     alignment and structure
>1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... Back     alignment and structure
>1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* Back     alignment and structure
>3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 3qkz_A* Back     alignment and structure
>3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} Back     alignment and structure
>1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... Back     alignment and structure
>1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 Back     alignment and structure
>1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 Back     alignment and structure
>3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} Back     alignment and structure
>3b3d_A YTBE protein, putative morphine dehydrogenase; aldo-keto reductase, oxidoreductase; 2.30A {Bacillus subtilis} Back     alignment and structure
>3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* Back     alignment and structure
>4gac_A Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldheyde reductase AKR1A4, SMAR1, oxidoreductase; HET: FLC; 1.64A {Mus musculus} PDB: 2alr_A 3h4g_A* 3cv7_A* 3fx4_A* 1ae4_A* 1cwn_A* 1hqt_A* Back     alignment and structure
>3cf4_A Acetyl-COA decarboxylase/synthase alpha subunit; methanomicrobia, iron-nikel-sulfur, 4Fe-NI-4S, oxidoreductas; 2.00A {Methanosarcina barkeri} Back     alignment and structure
>3jva_A Dipeptide epimerase; enolase superfamily, isomerase; 1.70A {Enterococcus faecalis V583} PDB: 3jw7_A* 3jzu_A* 3k1g_A* 3kum_A* Back     alignment and structure
>2poz_A Putative dehydratase; octamer, structural genomics, P protein structure initiative, NEW YORK SGX research center structural genomics, nysgxrc; 2.04A {Mesorhizobium loti} Back     alignment and structure
>3eez_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, unknown function, PSI-2, protein structure initiative; 2.80A {Silicibacter pomeroyi} Back     alignment and structure
>3i4k_A Muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9450D, isomerase, PSI-2, protein structure initiative; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>3q45_A Mandelate racemase/muconate lactonizing enzyme FA possible chloromuconate cycloisomerase...; (beta/alpha)8-barrel; 3.00A {Cytophaga hutchinsonii} PDB: 3q4d_A Back     alignment and structure
>2rdx_A Mandelate racemase/muconate lactonizing enzyme, P; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.00A {Roseovarius nubinhibens} Back     alignment and structure
>1nu5_A Chloromuconate cycloisomerase; enzyme, dehalogenation; 1.95A {Pseudomonas SP} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>1mdl_A Mandelate racemase; isomerase, mandelate pathway, magnesium; HET: RMN SMN; 1.85A {Pseudomonas aeruginosa} SCOP: c.1.11.2 d.54.1.1 PDB: 1mdr_A* 3uxk_A* 3uxl_A* 1dtn_A* 1mra_A* 2mnr_A 1mns_A Back     alignment and structure
>3gd6_A Muconate cycloisomerase; structural genomics, NYSGXRC, target 9375A, divergent enolase, lyase, PSI-2; 1.60A {Oceanobacillus iheyensis HTE831} PDB: 2oqy_A 3es8_A 3es7_A 3fyy_A 3hpf_A* Back     alignment and structure
>2o56_A Putative mandelate racemase; dehydratase, structural genomics, protein structure initiati 2; 2.00A {Salmonella typhimurium} Back     alignment and structure
>3fv9_G Mandelate racemase/muconate lactonizing enzyme; structural genomics, mandelate racemase/muconatelactonizing hydrolase, PSI-2; 1.90A {Roseovarius nubinhibens ism} PDB: 2pce_A Back     alignment and structure
>3r0u_A Enzyme of enolase superfamily; structural genomics, putative epimerase, PSI-biolog YORK structural genomics research consortium; HET: MSE TAR; 1.90A {Francisella philomiragia subsp} PDB: 3px5_A* 3r0k_A* 3r10_A 3r11_A 3r1z_A* Back     alignment and structure
>1tkk_A Similar to chloromuconate cycloisomerase; epimerase, enolase super family,; 2.10A {Bacillus subtilis} SCOP: c.1.11.2 d.54.1.1 PDB: 1jpm_A Back     alignment and structure
>2nql_A AGR_PAT_674P, isomerase/lactonizing enzyme; enolase, structural genomics, protein structure initiative, nysgxrc; 1.80A {Agrobacterium tumefaciens str} PDB: 4dn1_A Back     alignment and structure
>3tj4_A Mandelate racemase; enolase, dehydratase, enzyme function initiative, EFI, lyase; 1.50A {Agrobacterium tumefaciens} PDB: 4h19_A* Back     alignment and structure
>2ovl_A Putative racemase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.13A {Streptomyces coelicolor A3} PDB: 3ck5_A Back     alignment and structure
>3i6e_A Muconate cycloisomerase I; structural genomics, NYSGXRC, targer 9468A, muconate lactonizing enzyme, PSI-2, protein structure initiative; 1.70A {Ruegeria pomeroyi} PDB: 3i6t_A Back     alignment and structure
>3ik4_A Mandelate racemase/muconate lactonizing protein; structural genomics, enolase, epimerase, PSI-2, protein STRU initiative; 2.10A {Herpetosiphon aurantiacus atcc 23779} Back     alignment and structure
>3dg3_A Muconate cycloisomerase; muconate lactonizing enzyme, muconolactone binding; 1.60A {Mycobacterium smegmatis} PDB: 3dg6_A* 3dg7_A* Back     alignment and structure
>3mwc_A Mandelate racemase/muconate lactonizing protein; enolase, structural genomics, protein structure initiative, nysgrc; 1.80A {Kosmotoga olearia} Back     alignment and structure
>2pgw_A Muconate cycloisomerase; enolase superfamily, octamer, small metabolism, PSI-II, NYSGXRC, structural genomics, PR structure initiative; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>3ozy_A Putative mandelate racemase; beta-alpha barrel, enolase superfamily member, M-xylarate, U function; HET: DXL; 1.30A {Bordetella bronchiseptica} PDB: 3ozm_A* 3h12_A 3op2_A* Back     alignment and structure
>2qdd_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.30A {Roseovarius nubinhibens} PDB: 3fvd_B Back     alignment and structure
>2zad_A Muconate cycloisomerase; muconate lactonizing enzyme (MLE), TM0006, struct genomics, NPPSFA; HET: 1PE; 1.60A {Thermotoga maritima} PDB: 3deq_A 3der_A* 3des_A* 3dfy_A Back     alignment and structure
>1r0m_A N-acylamino acid racemase; isomerase; 1.30A {Deinococcus radiodurans} SCOP: c.1.11.2 d.54.1.1 PDB: 1xpy_A* 1xs2_A 2ggj_A 2ggi_A 2ggh_A* 2ggg_A* 2fkp_A Back     alignment and structure
>4e8g_A Enolase, mandelate racemase/muconate lactonizing enzyme, N domain protein; putative racemase, nysgrc, structural genomics, PSI-biology; 2.00A {Paracoccus denitrificans} Back     alignment and structure
>2ps2_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9440A, enolase superfamily, PSI-2; 1.80A {Aspergillus oryzae RIB40} Back     alignment and structure
>2og9_A Mandelate racemase/muconate lactonizing enzyme; NYSGXRC, protein structure initiative (PSI) II, PSI-2, 9382A mandelate racemase; 1.90A {Polaromonas SP} PDB: 3cb3_A* Back     alignment and structure
>2p8b_A Mandelate racemase/muconate lactonizing enzyme family protein; enolase superfamily, prediction of function; HET: NSK; 1.70A {Bacillus cereus atcc 14579} PDB: 2p88_A* 2p8c_A* Back     alignment and structure
>3ro6_B Putative chloromuconate cycloisomerase; TIM barrel; 2.20A {Methylococcus capsulatus} PDB: 3rit_A Back     alignment and structure
>2qde_A Mandelate racemase/muconate lactonizing enzyme FA protein; PSI-II, NYSGXRC, enolase, structural genomics, protei structure initiative, PSI-2; 1.93A {Azoarcus SP} Back     alignment and structure
>2pp0_A L-talarate/galactarate dehydratase; enolase superfamily, LYA; 2.20A {Salmonella typhimurium} PDB: 2pp1_A* 2pp3_A* Back     alignment and structure
>2ox4_A Putative mandelate racemase; enolase, dehydratase, structural genomics, protein structure initiative, PSI, nysgrc; 1.80A {Zymomonas mobilis} Back     alignment and structure
>4dwd_A Mandelate racemase/muconate lactonizing enzyme, C domain protein; structural genomics, EFI, enzyme function initiative, metal protein; HET: MSE; 1.50A {Paracoccus denitrificans} PDB: 3n4e_A* Back     alignment and structure
>3qld_A Mandelate racemase/muconate lactonizing protein; structural genomics, PSI-2, isomerase; HET: MSE; 1.85A {Alicyclobacillus acidocaldarius LAA1} Back     alignment and structure
>2qgy_A Enolase from the environmental genome shotgun sequencing of the sargasso SEA; structural genomics, unknown function, PSI-2; 1.80A {Environmental sample} Back     alignment and structure
>3s5s_A Mandelate racemase/muconate lactonizing enzyme FA protein; PSI-biology, structural genomics, NEW YORK structural genomi research consortium; 2.40A {Sorangium cellulosum} Back     alignment and structure
>2hzg_A Mandelate racemase/muconate lactonizing enzyme/EN superfamily; structural genomics, predicted mandelate racemase, PSI; 2.02A {Rhodobacter sphaeroides} Back     alignment and structure
>2zc8_A N-acylamino acid racemase; octamer, TIM beta/alpha-barrel, metal-binding, metal binding; 1.95A {Thermus thermophilus} Back     alignment and structure
>4h1z_A Enolase Q92ZS5; dehydratase, magnesium binding site, enzyme function initiat isomerase; 2.01A {Sinorhizobium meliloti} PDB: 2ppg_A Back     alignment and structure
>2gl5_A Putative dehydratase protein; structural genomics, protein structure initiati nysgxrc; 1.60A {Salmonella typhimurium} SCOP: c.1.11.2 d.54.1.1 PDB: 4e6m_A* Back     alignment and structure
>1sjd_A N-acylamino acid racemase; lyase, isomerase; HET: NPG; 1.87A {Amycolatopsis SP} SCOP: c.1.11.2 d.54.1.1 PDB: 1sja_A* 1sjb_A* 1sjc_A* Back     alignment and structure
>2qq6_A Mandelate racemase/muconate lactonizing enzyme- like protein; enolase, Mg ION, PSI-2, NYSGXRC, structural genomics; 2.90A {Rubrobacter xylanophilus dsm 9941} Back     alignment and structure
>2chr_A Chloromuconate cycloisomerase; 3.00A {Cupriavidus necator} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>3bjs_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI-2, protein struc initiative; 2.70A {Polaromonas SP} Back     alignment and structure
>1tzz_A Hypothetical protein L1841; structural genomics, mandelate racemase like fold, nysgxrc target T1523, PSI, protein structure initiative; 1.86A {Bradyrhizobium japonicum} SCOP: c.1.11.2 d.54.1.1 PDB: 2dw7_A* 2dw6_A* Back     alignment and structure
>3rr1_A GALD, putative D-galactonate dehydratase; enolase, magnesium binding site, lyase; 1.95A {Ralstonia pickettii} PDB: 3rra_A Back     alignment and structure
>1rvk_A Isomerase/lactonizing enzyme; enolase superfamily, MR.GI-17937161, NYSGXRC, target T1522, structural genomics, PSI; 1.70A {Agrobacterium tumefaciens} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>1wuf_A Hypothetical protein LIN2664; structural genomics, unknown function, nysgxrc target T2186, superfamily, protein structure initiative, PSI; 2.90A {Listeria innocua} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>3stp_A Galactonate dehydratase, putative; PSI biology, structural genomics, NEW YORK structural genomi research consortium; 1.88A {Labrenzia aggregata iam 12614} PDB: 3sqs_A 3ssz_A Back     alignment and structure
>3my9_A Muconate cycloisomerase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics, nysgx; 2.20A {Azorhizobium caulinodans} Back     alignment and structure
>4dye_A Isomerase; enolase family protein, EFI, enzym function initiative; 1.60A {Streptomyces coelicolor} PDB: 2oqh_A Back     alignment and structure
>3fcp_A L-Ala-D/L-Glu epimerase, A muconate lactonizing enzyme; structural genomics, nysgrc,target 9450E, PSI-2; 1.80A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3ddm_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9284B, enolase family, PSI-2; 2.60A {Bordetella bronchiseptica} Back     alignment and structure
>3toy_A Mandelate racemase/muconate lactonizing enzyme FA protein; enolase, magnesium binding site, lyase; HET: P4C; 1.80A {Bradyrhizobium SP} PDB: 3tte_A* Back     alignment and structure
>3sjn_A Mandelate racemase/muconate lactonizing protein; enolase, magnesium binding site, lyase; 1.90A {Shewanella pealeana} Back     alignment and structure
>1chr_A Chloromuconate cycloisomerase; 3.00A {Ralstonia eutropha} PDB: 2chr_A Back     alignment and structure
>2gdq_A YITF; mandelate racemase/muconate lactonizing enzyme, TIM-barrel, octamer, structural genomics, PSI; 1.80A {Bacillus subtilis subsp} SCOP: c.1.11.2 d.54.1.1 PDB: 2gge_A Back     alignment and structure
>3u9i_A Mandelate racemase/muconate lactonizing enzyme, C domain protein; structural genomics, PSI-biology; 2.90A {Roseiflexus SP} Back     alignment and structure
>4a35_A Mitochondrial enolase superfamily member 1; isomerase; 1.74A {Homo sapiens} Back     alignment and structure
>3va8_A Probable dehydratase; enolase, magnesium binding site, lyase; 2.00A {Gibberella zeae} Back     alignment and structure
>2ozt_A TLR1174 protein; structural genomics, O-succinylbenzoate synthase, PSI, protein structure initiative; 1.42A {Synechococcus elongatus} PDB: 3h7v_A Back     alignment and structure
>4e5t_A Mandelate racemase / muconate lactonizing enzyme, terminal domain protein; aldolase, structural genomics, biology; 2.90A {Labrenzia alexandrii} Back     alignment and structure
>2hxt_A L-fuconate dehydratase; enolase superfamily, D-erythromohydr unknown function; HET: EHM; 1.70A {Xanthomonas campestris PV} PDB: 1yey_A 2hxu_A* 2hne_A Back     alignment and structure
>3vdg_A Probable glucarate dehydratase; enolase, magnesium binding site, lyase; 1.90A {Mycobacterium smegmatis str} PDB: 3vfc_A* Back     alignment and structure
>3dgb_A Muconate cycloisomerase; muconate lactonizing enzyme, muconolactone binding, isomeras structural genomics, PSI-2; HET: MUC; 1.70A {Pseudomonas fluorescens} PDB: 3ct2_A* 3fj4_A* 1muc_A 1bkh_A 3muc_A 2muc_A 1f9c_A Back     alignment and structure
>2oz8_A MLL7089 protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.48A {Mesorhizobium loti} Back     alignment and structure
>3r4e_A Mandelate racemase/muconate lactonizing enzyme; enolase fold, mannonate dehydratase, D-mannonate, lyase; HET: CS2; 1.65A {Novosphingobium aromaticivorans} PDB: 2qjj_A 2qjn_A* 2qjm_A* Back     alignment and structure
>4h83_A Mandelate racemase/muconate lactonizing enzyme; structural genomics, enzyme function initiative; 2.09A {Marine actinobacterium PHSC20C1} PDB: 3no1_A 3msy_A Back     alignment and structure
>4hnl_A Mandelate racemase/muconate lactonizing enzyme; dehydratase, magnesium binding, enzyme function initiative,; 1.48A {Enterococcus gallinarum EG2} PDB: 3s47_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 242
d1pyfa_311 c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillu 6e-44
d1lqaa_346 c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 3e-43
d3eaua1326 c.1.7.1 (A:36-361) Voltage-dependent K+ channel be 3e-37
d1s1pa_315 c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (ak 5e-34
d1pz1a_333 c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillu 1e-31
d1us0a_314 c.1.7.1 (A:) Aldose reductase (aldehyde reductase) 3e-31
d1qwka_312 c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematod 9e-31
d1afsa_319 c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase 2e-30
d1vp5a_284 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 6e-29
d1hqta_324 c.1.7.1 (A:) Aldose reductase (aldehyde reductase) 1e-28
d1mi3a_319 c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenu 2e-28
d1mzra_274 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 2e-27
d1frba_315 c.1.7.1 (A:) FR-1 (fibroblast growth factor-induce 9e-26
d1ur3m_298 c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Esc 5e-25
d1hw6a_262 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 3e-21
d1gvea_ 324 c.1.7.1 (A:) Aflatoxin aldehyde reductase (akr7a1) 2e-20
>d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} Length = 311 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: NAD(P)-linked oxidoreductase
family: Aldo-keto reductases (NADP)
domain: Putative oxidoreductase IolS
species: Bacillus subtilis [TaxId: 1423]

 Score =  148 bits (373), Expect = 6e-44
 Identities = 69/214 (32%), Positives = 114/214 (53%), Gaps = 3/214 (1%)

Query: 11  RVKLGSQGLEVSRLGFGCGGLSGIYNKP-LSHEVGCSIIKETFNRGITLFDTSDVYGVDH 69
           + KLG   L+V  +G G   + G    P L+ E G  +++E    G+T+ DT+ +YG   
Sbjct: 2   KAKLGKSDLQVFPIGLGTNAVGGHNLYPNLNEETGKELVREAIRNGVTMLDTAYIYG-IG 60

Query: 70  DNEIMVGKALKQLPRDKIQLATKFGCFMLDGVSIGVKGSPEYVRKCCEASLKRLDVDYID 129
            +E ++G+ L++  R+ + +ATK       G       SP++++K  + SLKRL+ DYID
Sbjct: 61  RSEELIGEVLREFNREDVVIATKAAHRK-QGNDFVFDNSPDFLKKSVDESLKRLNTDYID 119

Query: 130 LYYQHRVDTSVSIEDTMGELKKLVEEGKIKYIGLSEASADTIRRAHAVHPITAVQMEYSL 189
           L+Y H  D     ++ +  L ++ + GKI+ IG+S  S + ++ A+    +  +Q EY+L
Sbjct: 120 LFYIHFPDEHTPKDEAVNALNEMKKAGKIRSIGVSNFSLEQLKEANKDGLVDVLQGEYNL 179

Query: 190 WTREIEDDIIPLCRELGIGIVAYSPLGRGFFAGK 223
             RE E    P  +E  I  + Y PL  G  AGK
Sbjct: 180 LNREAEKTFFPYTKEHNISFIPYFPLVSGLLAGK 213
>d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} Length = 346 Back     information, alignment and structure
>d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 326 Back     information, alignment and structure
>d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} Length = 333 Back     information, alignment and structure
>d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} Length = 314 Back     information, alignment and structure
>d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 312 Back     information, alignment and structure
>d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 319 Back     information, alignment and structure
>d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} Length = 284 Back     information, alignment and structure
>d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} Length = 324 Back     information, alignment and structure
>d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} Length = 319 Back     information, alignment and structure
>d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} Length = 274 Back     information, alignment and structure
>d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 315 Back     information, alignment and structure
>d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} Length = 298 Back     information, alignment and structure
>d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} Length = 262 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query242
d1pyfa_311 Putative oxidoreductase IolS {Bacillus subtilis [T 100.0
d1pz1a_333 Putative oxidoreductase YhdN {Bacillus subtilis [T 100.0
d1ur3m_298 Hypothetical oxidoreductase YdhF {Escherichia coli 100.0
d1lqaa_346 Tas protein {Escherichia coli [TaxId: 562]} 100.0
d1gvea_ 324 Aflatoxin aldehyde reductase (akr7a1) {Rat (Rattus 100.0
d3eaua1326 Voltage-dependent K+ channel beta subunit {Rat (Ra 100.0
d1hw6a_262 2,5-diketo-D-gluconic acid reductase A {Corynebact 100.0
d1qwka_312 Hypothetical protein C07D8.6 {Nematode (Caenorhabd 100.0
d1s1pa_315 Prostaglandin d2 11-ketoreductase (akr1c3) {Human 100.0
d1us0a_314 Aldose reductase (aldehyde reductase) {Human (Homo 100.0
d1afsa_319 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus 100.0
d1mzra_274 2,5-diketo-D-gluconic acid reductase A {Escherichi 100.0
d1mi3a_319 Xylose reductase {Fungi (Candida tenuis) [TaxId: 4 100.0
d1vp5a_284 2,5-diketo-D-gluconic acid reductase A {Thermotoga 100.0
d1hqta_324 Aldose reductase (aldehyde reductase) {Pig (Sus sc 100.0
d1frba_315 FR-1 (fibroblast growth factor-induced) protein {M 100.0
d1sjda1242 N-acylamino acid racemase {Amycolatopsis sp. [TaxI 94.72
d1jpma1234 L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 93.15
d1nu5a1243 Chlormuconate cycloisomerase {Pseudomonas sp. p51 93.09
d1r0ma1243 N-acylamino acid racemase {Deinococcus radiodurans 92.99
d1wufa1244 N-acylamino acid racemase {Listeria innocua [TaxId 92.5
d2chra1244 Chlormuconate cycloisomerase {Alcaligenes eutrophu 92.06
d1kcza1253 beta-Methylaspartase {Clostridium tetanomorphum [T 91.18
d1wuea1241 N-acylamino acid racemase {Enterococcus faecalis [ 91.04
d1kkoa1251 beta-Methylaspartase {Citrobacter amalonaticus [Ta 89.96
d2gl5a1278 Putative dehydratase protein STM2273 {Salmonella t 87.58
d1rvka1255 Hypothetical protein Atu3453 {Agrobacterium tumefa 85.88
d1yeya1252 RTS beta protein {Xanthomonas campestris pv. campe 84.91
d2gdqa1256 Hypothetical protein YitF {Bacillus subtilis [TaxI 84.45
d1tzza1247 Hypothetical protein Bll6730 {Bradyrhizobium japon 83.4
d1jdfa1309 D-glucarate dehydratase {Escherichia coli [TaxId: 82.49
d1xm3a_251 Thiazole biosynthesis protein ThiG {Bacillus subti 80.8
>d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: NAD(P)-linked oxidoreductase
family: Aldo-keto reductases (NADP)
domain: Putative oxidoreductase IolS
species: Bacillus subtilis [TaxId: 1423]

Probab=100.00  E-value=9.3e-50  Score=340.90  Aligned_cols=222  Identities=31%  Similarity=0.574  Sum_probs=200.2

Q ss_pred             CeeecCCCCcccccceecccccCCc-CCCCCCHHHHHHHHHHHHHcCCCEEeCccccCCCChhHHHHHHHHhcCCCCCEE
Q 026166           10 PRVKLGSQGLEVSRLGFGCGGLSGI-YNKPLSHEVGCSIIKETFNRGITLFDTSDVYGVDHDNEIMVGKALKQLPRDKIQ   88 (242)
Q Consensus        10 ~~~~lg~~g~~vs~lglG~~~~~~~-~~~~~~~~~~~~~l~~A~~~Gi~~~DtA~~Yg~~g~~e~~lg~~l~~~~R~~l~   88 (242)
                      ++++||+||++||+||||||++|+. +....+.+++.++|++|++.|||+||||+.||. |.+|+.+|++++..+|++++
T Consensus         1 ~~~rLG~tgl~vS~iglGt~~~g~~~~~~~~~~~~a~~~l~~A~~~Gin~~DTA~~Yg~-g~sE~~lg~~l~~~~r~~~~   79 (311)
T d1pyfa_           1 KKAKLGKSDLQVFPIGLGTNAVGGHNLYPNLNEETGKELVREAIRNGVTMLDTAYIYGI-GRSEELIGEVLREFNREDVV   79 (311)
T ss_dssp             CCEECTTSCCEECSBCEECTTSSCTTTCSSCCHHHHHHHHHHHHHTTCCEEECCTTTTT-THHHHHHHHHHTTSCGGGCE
T ss_pred             CCcccCCCCCeecceeeeCcccCCCCCCCCCCHHHHHHHHHHHHHcCCCEEEehhhcCC-CccHHHHhhhhhccccccee
Confidence            4799999999999999999999863 233458999999999999999999999999997 89999999999988899999


Q ss_pred             EEeecCcccCCCcccCCCCCHHHHHHHHHHHHHHcCCCcccEEEeccCCCCCCHHHHHHHHHHHHHcCCcceEecCCCCH
Q 026166           89 LATKFGCFMLDGVSIGVKGSPEYVRKCCEASLKRLDVDYIDLYYQHRVDTSVSIEDTMGELKKLVEEGKIKYIGLSEASA  168 (242)
Q Consensus        89 I~tK~~~~~~~~~~~~~~~~~~~i~~~l~~sL~~L~~d~iDl~~lh~p~~~~~~~~~~~~l~~l~~~G~i~~iGvS~~~~  168 (242)
                      |+||++..... .....+.+++.+++++++||++|++||+|++++|+|+...+.+++|++|++|+++|+|++||+|++++
T Consensus        80 i~tK~~~~~~~-~~~~~~~~~~~i~~s~~~SL~rl~~d~iDl~~lh~~~~~~~~~~~~~~l~~l~~~Gkir~iGvs~~~~  158 (311)
T d1pyfa_          80 IATKAAHRKQG-NDFVFDNSPDFLKKSVDESLKRLNTDYIDLFYIHFPDEHTPKDEAVNALNEMKKAGKIRSIGVSNFSL  158 (311)
T ss_dssp             EEEEECEEEET-TEEEECCCHHHHHHHHHHHHHHHTSSCBSEEEECSCCSSSCHHHHHHHHHHHHHTTSBSCEEEESCCH
T ss_pred             cceeccCCCCC-cccccccchHHHHHHHHhhHHhhCCcHHhhhcccCCCcccchhhHHHHHHHHHhCCeEEeecccCCcH
Confidence            99999865532 22345678999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhccCCceEEecccCccCcChhhhHHHHHHHhCCcEEecccCccccCCCC-CCCCCCCCCc
Q 026166          169 DTIRRAHAVHPITAVQMEYSLWTREIEDDIIPLCRELGIGIVAYSPLGRGFFAGK-AVVESLPSES  233 (242)
Q Consensus       169 ~~l~~~~~~~~~~~~q~~~~~~~~~~~~~l~~~~~~~gi~v~a~spl~~G~L~~~-~~~~~~~~~~  233 (242)
                      +.+.++.+..+++++|++||++++....+++++|+++||++++|+||++|+|+++ ......|...
T Consensus       159 ~~~~~~~~~~~~~~~q~~~n~~~~~~~~~~~~~~~~~~i~v~~~~~l~~G~l~~~~~~~~~~~~~~  224 (311)
T d1pyfa_         159 EQLKEANKDGLVDVLQGEYNLLNREAEKTFFPYTKEHNISFIPYFPLVSGLLAGKYTEDTTFPEGD  224 (311)
T ss_dssp             HHHHHHTTTSCCCEEEEECBTTBCGGGTTHHHHHHHHTCEEEEESTTTTTGGGTCCCTTCCCCTTC
T ss_pred             HHHHHHhhcCCcceEeeeecccchhhhHHHHHHHHHCCceEEEeccccCCccCCCcCcCCCCcccc
Confidence            9999999999999999999999998778999999999999999999999999998 4444444433
>d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} Back     information, alignment and structure
>d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} Back     information, alignment and structure
>d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sjda1 c.1.11.2 (A:126-367) N-acylamino acid racemase {Amycolatopsis sp. [TaxId: 37632]} Back     information, alignment and structure
>d1jpma1 c.1.11.2 (A:126-359) L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nu5a1 c.1.11.2 (A:127-369) Chlormuconate cycloisomerase {Pseudomonas sp. p51 [TaxId: 65067]} Back     information, alignment and structure
>d1r0ma1 c.1.11.2 (A:133-375) N-acylamino acid racemase {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1wufa1 c.1.11.2 (A:1127-1370) N-acylamino acid racemase {Listeria innocua [TaxId: 1642]} Back     information, alignment and structure
>d2chra1 c.1.11.2 (A:127-370) Chlormuconate cycloisomerase {Alcaligenes eutrophus [TaxId: 106590]} Back     information, alignment and structure
>d1kcza1 c.1.11.2 (A:161-413) beta-Methylaspartase {Clostridium tetanomorphum [TaxId: 1553]} Back     information, alignment and structure
>d1wuea1 c.1.11.2 (A:1127-1367) N-acylamino acid racemase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1kkoa1 c.1.11.2 (A:161-411) beta-Methylaspartase {Citrobacter amalonaticus [TaxId: 35703]} Back     information, alignment and structure
>d2gl5a1 c.1.11.2 (A:123-400) Putative dehydratase protein STM2273 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1rvka1 c.1.11.2 (A:127-381) Hypothetical protein Atu3453 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1yeya1 c.1.11.2 (A:184-435) RTS beta protein {Xanthomonas campestris pv. campestris [TaxId: 340]} Back     information, alignment and structure
>d2gdqa1 c.1.11.2 (A:119-374) Hypothetical protein YitF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tzza1 c.1.11.2 (A:1146-1392) Hypothetical protein Bll6730 {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1jdfa1 c.1.11.2 (A:138-446) D-glucarate dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xm3a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure