Citrus Sinensis ID: 026175

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240--
MESIQAKQGLVGPNDPIQRTQLPYVTGTSVVALKYKDGILMAADMGGSYGSTIRYKSVERIKPIGKHSLLGASGEISDFQELLRNLDELILYDNMWDDGNSLGPKELHSYLTRVMYNRRNKFDPLWNSLVLGGVKNGQKYLGMVSMIGVNFEDSHVATGFGNHLARPILRDEWHENLSYEDGVKLLEKCMRVLLYRDRSAVNKLQIAKITEEGTTISQPYALKTFWGFTAFQNPTAGAEGSW
cccccccccccccccccccccccccccccEEEEEEccEEEEEEccccccccEEEcccccCEEEEccCEEEEccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccccccccEEEEEEECccccEEEEEcccccCECccEEEEcccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHccccccccEEEEEEcccccEEEcccccccccccccECcccccccccc
*******************TQLPYVTGTSVVALKYKDGILMAADMGGSYGSTIRYKSVERIKPIGKHSLLGASGEISDFQELLRNLDELILYDNMWDDGNSLGPKELHSYLTRVMYNRRNKFDPLWNSLVLGGVKNGQKYLGMVSMIGVNFEDSHVATGFGNHLARPILRDEWHENLSYEDGVKLLEKCMRVLLYRDRSAVNKLQIAKITEEGTTISQPYALKTFWGFTAFQNPT******W
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESIQAKQGLVGPNDPIQRTQLPYVTGTSVVALKYKDGILMAADMGGSYGSTIRYKSVERIKPIGKHSLLGASGEISDFQELLRNLDELILYDNMWDDGNSLGPKELHSYLTRVMYNRRNKFDPLWNSLVLGGVKNGQKYLGMVSMIGVNFEDSHVATGFGNHLARPILRDEWHENLSYEDGVKLLEKCMRVLLYRDRSAVNKLQIAKITEEGTTISQPYALKTFWGFTAFQNPTAGAEGSW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Proteasome subunit beta type-4 The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity.confidentQ7DLR9
Probable proteasome subunit beta type-7 The proteasome degrades poly-ubiquitinated proteins in the cytoplasm and in the nucleus. It is essential for the regulated turnover of proteins and for the removal of misfolded proteins. The proteasome is a multicatalytic proteinase complex that is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. It has an ATP-dependent proteolytic activity.probableQ8SS01
Proteasome subunit beta type-4 The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. SMAD1/OAZ1/PSMB4 complex mediates the degradation of the CREBBP/EP300 repressor SNIP1.probableP34067

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.4.-.-Acting on peptide bonds (peptide hydrolases).probable
3.4.25.-Threonine endopeptidases.probable
3.4.25.1Transferred entry: 3.4.25.1.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1IRU, chain N
Confidence level:very confident
Coverage over the Query: 20-234
View the alignment between query and template
View the model in PyMOL