Citrus Sinensis ID: 026175
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 242 | ||||||
| 449463653 | 245 | PREDICTED: proteasome subunit beta type- | 0.995 | 0.983 | 0.838 | 1e-119 | |
| 225435249 | 245 | PREDICTED: proteasome subunit beta type- | 0.929 | 0.918 | 0.906 | 1e-119 | |
| 224141787 | 244 | predicted protein [Populus trichocarpa] | 0.991 | 0.983 | 0.829 | 1e-118 | |
| 224089062 | 244 | predicted protein [Populus trichocarpa] | 0.975 | 0.967 | 0.813 | 1e-115 | |
| 297848158 | 246 | hypothetical protein ARALYDRAFT_474808 [ | 0.929 | 0.914 | 0.848 | 1e-114 | |
| 3421123 | 246 | 20S proteasome beta subunit PBG1 [Arabid | 0.929 | 0.914 | 0.844 | 1e-113 | |
| 15223537 | 246 | proteasome subunit beta type-4 [Arabidop | 0.929 | 0.914 | 0.84 | 1e-113 | |
| 351722547 | 232 | uncharacterized protein LOC100527174 [Gl | 0.929 | 0.969 | 0.844 | 1e-113 | |
| 449531344 | 221 | PREDICTED: proteasome subunit beta type- | 0.909 | 0.995 | 0.863 | 1e-112 | |
| 357500387 | 232 | Proteasome subunit beta type [Medicago t | 0.929 | 0.969 | 0.844 | 1e-112 |
| >gi|449463653|ref|XP_004149546.1| PREDICTED: proteasome subunit beta type-4-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Score = 434 bits (1115), Expect = e-119, Method: Compositional matrix adjust.
Identities = 202/241 (83%), Positives = 225/241 (93%)
Query: 2 ESIQAKQGLVGPNDPIQRTQLPYVTGTSVVALKYKDGILMAADMGGSYGSTIRYKSVERI 61
+S QA GL+ P PIQRTQ PYVTGTSVVA+KYKDGILM +D+GGSYGST+RYKSVERI
Sbjct: 5 DSNQANHGLLCPEAPIQRTQYPYVTGTSVVAIKYKDGILMVSDLGGSYGSTLRYKSVERI 64
Query: 62 KPIGKHSLLGASGEISDFQELLRNLDELILYDNMWDDGNSLGPKELHSYLTRVMYNRRNK 121
K IGKHSLLGASGEISDFQ+LLR+LD+LILYDNMWDDGN+LGPKE+HSYLTRVMYNRRNK
Sbjct: 65 KAIGKHSLLGASGEISDFQQLLRDLDQLILYDNMWDDGNALGPKEIHSYLTRVMYNRRNK 124
Query: 122 FDPLWNSLVLGGVKNGQKYLGMVSMIGVNFEDSHVATGFGNHLARPILRDEWHENLSYED 181
FDP WN+LVLGGVKNGQKYLG V+MIGV FED+HV TGFGNHLARPILRDEW E+L++E+
Sbjct: 125 FDPYWNALVLGGVKNGQKYLGTVNMIGVTFEDNHVTTGFGNHLARPILRDEWREDLTFEE 184
Query: 182 GVKLLEKCMRVLLYRDRSAVNKLQIAKITEEGTTISQPYALKTFWGFTAFQNPTAGAEGS 241
GVKLLEKCMRVLLYRDRSAVNKLQIAKITEEG TISQPY+LKTFW ++AF+NPT+GAEGS
Sbjct: 185 GVKLLEKCMRVLLYRDRSAVNKLQIAKITEEGVTISQPYSLKTFWNYSAFENPTSGAEGS 244
Query: 242 W 242
W
Sbjct: 245 W 245
|
Source: Cucumis sativus Species: Cucumis sativus Genus: Cucumis Family: Cucurbitaceae Order: Cucurbitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225435249|ref|XP_002284989.1| PREDICTED: proteasome subunit beta type-4 isoform 1 [Vitis vinifera] gi|297746225|emb|CBI16281.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224141787|ref|XP_002324245.1| predicted protein [Populus trichocarpa] gi|222865679|gb|EEF02810.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224089062|ref|XP_002308619.1| predicted protein [Populus trichocarpa] gi|222854595|gb|EEE92142.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|297848158|ref|XP_002891960.1| hypothetical protein ARALYDRAFT_474808 [Arabidopsis lyrata subsp. lyrata] gi|297337802|gb|EFH68219.1| hypothetical protein ARALYDRAFT_474808 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|3421123|gb|AAC32074.1| 20S proteasome beta subunit PBG1 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|15223537|ref|NP_176040.1| proteasome subunit beta type-4 [Arabidopsis thaliana] gi|82581521|sp|Q7DLR9.2|PSB4_ARATH RecName: Full=Proteasome subunit beta type-4; AltName: Full=20S proteasome beta subunit G-1; AltName: Full=Proteasome component H; AltName: Full=Proteasome subunit beta type-7; Flags: Precursor gi|12323023|gb|AAG51500.1|AC058785_3 20S proteasome beta subunit (PBG1) [Arabidopsis thaliana] gi|14190405|gb|AAK55683.1|AF378880_1 At1g56450/F13N6_3 [Arabidopsis thaliana] gi|15010590|gb|AAK73954.1| At1g56450/F13N6_3 [Arabidopsis thaliana] gi|15450551|gb|AAK96453.1| At1g56450/F13N6_3 [Arabidopsis thaliana] gi|62320870|dbj|BAD93840.1| putative protein [Arabidopsis thaliana] gi|332195276|gb|AEE33397.1| proteasome subunit beta type-4 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|351722547|ref|NP_001235968.1| uncharacterized protein LOC100527174 [Glycine max] gi|255631716|gb|ACU16225.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449531344|ref|XP_004172646.1| PREDICTED: proteasome subunit beta type-4-like, partial [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|357500387|ref|XP_003620482.1| Proteasome subunit beta type [Medicago truncatula] gi|355495497|gb|AES76700.1| Proteasome subunit beta type [Medicago truncatula] gi|388498504|gb|AFK37318.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 242 | ||||||
| TAIR|locus:2010693 | 246 | PBG1 "20S proteasome beta subu | 0.929 | 0.914 | 0.84 | 2.8e-105 | |
| UNIPROTKB|Q3T108 | 264 | PSMB4 "Proteasome subunit beta | 0.917 | 0.840 | 0.455 | 7.2e-52 | |
| UNIPROTKB|F1ST02 | 264 | PSMB4 "Proteasome subunit beta | 0.871 | 0.799 | 0.464 | 2.4e-51 | |
| UNIPROTKB|E2RBR6 | 264 | PSMB4 "Proteasome subunit beta | 0.871 | 0.799 | 0.455 | 8.3e-51 | |
| UNIPROTKB|P28070 | 264 | PSMB4 "Proteasome subunit beta | 0.871 | 0.799 | 0.460 | 8.3e-51 | |
| MGI|MGI:1098257 | 264 | Psmb4 "proteasome (prosome, ma | 0.871 | 0.799 | 0.460 | 1.1e-50 | |
| UNIPROTKB|D4A640 | 232 | Psmb4 "Proteasome subunit beta | 0.884 | 0.922 | 0.453 | 1.3e-50 | |
| RGD|61877 | 263 | Psmb4 "proteasome (prosome, ma | 0.884 | 0.813 | 0.453 | 1.7e-50 | |
| UNIPROTKB|P34067 | 263 | Psmb4 "Proteasome subunit beta | 0.884 | 0.813 | 0.453 | 1.7e-50 | |
| UNIPROTKB|P28024 | 242 | psmb4 "Proteasome subunit beta | 0.871 | 0.871 | 0.436 | 2.8e-50 |
| TAIR|locus:2010693 PBG1 "20S proteasome beta subunit G1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1042 (371.9 bits), Expect = 2.8e-105, P = 2.8e-105
Identities = 189/225 (84%), Positives = 212/225 (94%)
Query: 18 QRTQLPYVTGTSVVALKYKDGILMAADMGGSYGSTIRYKSVERIKPIGKHSLLGASGEIS 77
QRT PYVTGTS+VA+KYKDG+LMA+DMGGSYGST+RYK++ER+K IGKHSLLGASGEIS
Sbjct: 22 QRTLYPYVTGTSIVAIKYKDGVLMASDMGGSYGSTLRYKNIERVKAIGKHSLLGASGEIS 81
Query: 78 DFQELLRNLDELILYDNMWDDGNSLGPKELHSYLTRVMYNRRNKFDPLWNSLVLGGVKNG 137
DFQE+LR LDEL L DNMWDDGNSLGPKE+H+YLTRVMYNRRNKF+PLWN+LVLGGVKNG
Sbjct: 82 DFQEILRYLDELTLNDNMWDDGNSLGPKEIHNYLTRVMYNRRNKFNPLWNTLVLGGVKNG 141
Query: 138 QKYLGMVSMIGVNFEDSHVATGFGNHLARPILRDEWHENLSYEDGVKLLEKCMRVLLYRD 197
+ YLGMVSMIGV+FED HVATGFGNHLARPILRDEWH +LS+EDGVKLLEKCMRVLLYRD
Sbjct: 142 KSYLGMVSMIGVSFEDDHVATGFGNHLARPILRDEWHADLSFEDGVKLLEKCMRVLLYRD 201
Query: 198 RSAVNKLQIAKITEEGTTISQPYALKTFWGFTAFQNPTAGAEGSW 242
RSA+NKLQIAKITEEG T+SQPY+LKT+W F++F NPTAGA GSW
Sbjct: 202 RSAINKLQIAKITEEGVTVSQPYSLKTYWEFSSFHNPTAGAAGSW 246
|
|
| UNIPROTKB|Q3T108 PSMB4 "Proteasome subunit beta type-4" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1ST02 PSMB4 "Proteasome subunit beta type" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RBR6 PSMB4 "Proteasome subunit beta type" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P28070 PSMB4 "Proteasome subunit beta type-4" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1098257 Psmb4 "proteasome (prosome, macropain) subunit, beta type 4" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D4A640 Psmb4 "Proteasome subunit beta type" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| RGD|61877 Psmb4 "proteasome (prosome, macropain) subunit, beta type 4" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P34067 Psmb4 "Proteasome subunit beta type-4" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P28024 psmb4 "Proteasome subunit beta type-4" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 242 | |||
| cd03760 | 197 | cd03760, proteasome_beta_type_4, proteasome beta t | 1e-111 | |
| cd01912 | 189 | cd01912, proteasome_beta, proteasome beta subunit | 2e-58 | |
| cd01906 | 182 | cd01906, proteasome_protease_HslV, proteasome_prot | 4e-48 | |
| pfam00227 | 188 | pfam00227, Proteasome, Proteasome subunit | 2e-37 | |
| COG0638 | 236 | COG0638, PRE1, 20S proteasome, alpha and beta subu | 3e-36 | |
| cd01901 | 164 | cd01901, Ntn_hydrolase, The Ntn hydrolases (N-term | 2e-30 | |
| TIGR03634 | 185 | TIGR03634, arc_protsome_B, proteasome endopeptidas | 1e-23 | |
| cd03764 | 188 | cd03764, proteasome_beta_archeal, Archeal proteaso | 6e-23 | |
| cd03758 | 193 | cd03758, proteasome_beta_type_2, proteasome beta t | 2e-12 | |
| cd03757 | 212 | cd03757, proteasome_beta_type_1, proteasome beta t | 2e-11 | |
| cd03759 | 195 | cd03759, proteasome_beta_type_3, proteasome beta t | 2e-07 | |
| cd03762 | 188 | cd03762, proteasome_beta_type_6, proteasome beta t | 8e-06 | |
| cd03763 | 189 | cd03763, proteasome_beta_type_7, proteasome beta t | 3e-05 | |
| TIGR03633 | 224 | TIGR03633, arc_protsome_A, proteasome endopeptidas | 8e-05 | |
| cd03756 | 211 | cd03756, proteasome_alpha_archeal, proteasome_alph | 1e-04 | |
| TIGR03690 | 219 | TIGR03690, 20S_bact_beta, proteasome, beta subunit | 3e-04 |
| >gnl|CDD|239729 cd03760, proteasome_beta_type_4, proteasome beta type-4 subunit | Back alignment and domain information |
|---|
Score = 318 bits (817), Expect = e-111
Identities = 112/197 (56%), Positives = 153/197 (77%), Gaps = 3/197 (1%)
Query: 26 TGTSVVALKYKDGILMAADMGGSYGSTIRYKSVERIKPIGKHSLLGASGEISDFQELLRN 85
TGTSV+A+KYKDG+++AAD GSYGS R+K+VERI +G ++LLGASG+ +DFQ L R
Sbjct: 1 TGTSVIAIKYKDGVIIAADTLGSYGSLARFKNVERIFKVGDNTLLGASGDYADFQYLKRL 60
Query: 86 LDELILYDNMWDDGNSLGPKELHSYLTRVMYNRRNKFDPLWNSLVLGGVKN-GQKYLGMV 144
LD+L++ D DDG+SL PKE+HSYLTRV+YNRR+K +PLWN+LV+GGV N G+ +LG V
Sbjct: 61 LDQLVIDDECLDDGHSLSPKEIHSYLTRVLYNRRSKMNPLWNTLVVGGVDNEGEPFLGYV 120
Query: 145 SMIGVNFEDSHVATGFGNHLARPILRDEWHE--NLSYEDGVKLLEKCMRVLLYRDRSAVN 202
++G +ED HVATGFG +LA P+LR+ W + +L+ E+ L+E+CM+VL YRD ++N
Sbjct: 121 DLLGTAYEDPHVATGFGAYLALPLLREAWEKKPDLTEEEARALIEECMKVLYYRDARSIN 180
Query: 203 KLQIAKITEEGTTISQP 219
K QIA +T+EG I P
Sbjct: 181 KYQIAVVTKEGVEIEGP 197
|
The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis.Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each. Length = 197 |
| >gnl|CDD|238893 cd01912, proteasome_beta, proteasome beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|238887 cd01906, proteasome_protease_HslV, proteasome_protease_HslV | Back alignment and domain information |
|---|
| >gnl|CDD|215805 pfam00227, Proteasome, Proteasome subunit | Back alignment and domain information |
|---|
| >gnl|CDD|223711 COG0638, PRE1, 20S proteasome, alpha and beta subunits [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|238884 cd01901, Ntn_hydrolase, The Ntn hydrolases (N-terminal nucleophile) are a diverse superfamily of of enzymes that are activated autocatalytically via an N-terminally lcated nucleophilic amino acid | Back alignment and domain information |
|---|
| >gnl|CDD|234287 TIGR03634, arc_protsome_B, proteasome endopeptidase complex, archaeal, beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|239733 cd03764, proteasome_beta_archeal, Archeal proteasome, beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|239727 cd03758, proteasome_beta_type_2, proteasome beta type-2 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|239726 cd03757, proteasome_beta_type_1, proteasome beta type-1 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|239728 cd03759, proteasome_beta_type_3, proteasome beta type-3 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|239731 cd03762, proteasome_beta_type_6, proteasome beta type-6 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|239732 cd03763, proteasome_beta_type_7, proteasome beta type-7 subunit | Back alignment and domain information |
|---|
| >gnl|CDD|163366 TIGR03633, arc_protsome_A, proteasome endopeptidase complex, archaeal, alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|239725 cd03756, proteasome_alpha_archeal, proteasome_alpha_archeal | Back alignment and domain information |
|---|
| >gnl|CDD|163402 TIGR03690, 20S_bact_beta, proteasome, beta subunit, bacterial type | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 242 | |||
| cd03750 | 227 | proteasome_alpha_type_2 proteasome_alpha_type_2. T | 100.0 | |
| COG0638 | 236 | PRE1 20S proteasome, alpha and beta subunits [Post | 100.0 | |
| cd03760 | 197 | proteasome_beta_type_4 proteasome beta type-4 subu | 100.0 | |
| PRK03996 | 241 | proteasome subunit alpha; Provisional | 100.0 | |
| TIGR03633 | 224 | arc_protsome_A proteasome endopeptidase complex, a | 100.0 | |
| PTZ00246 | 253 | proteasome subunit alpha; Provisional | 100.0 | |
| KOG0176 | 241 | consensus 20S proteasome, regulatory subunit alpha | 100.0 | |
| cd03759 | 195 | proteasome_beta_type_3 proteasome beta type-3 subu | 100.0 | |
| cd03751 | 212 | proteasome_alpha_type_3 proteasome_alpha_type_3. T | 100.0 | |
| cd03761 | 188 | proteasome_beta_type_5 proteasome beta type-5 subu | 100.0 | |
| cd03757 | 212 | proteasome_beta_type_1 proteasome beta type-1 subu | 100.0 | |
| PTZ00488 | 247 | Proteasome subunit beta type-5; Provisional | 100.0 | |
| cd03758 | 193 | proteasome_beta_type_2 proteasome beta type-2 subu | 100.0 | |
| TIGR03634 | 185 | arc_protsome_B proteasome endopeptidase complex, a | 100.0 | |
| cd03752 | 213 | proteasome_alpha_type_4 proteasome_alpha_type_4. T | 100.0 | |
| cd03764 | 188 | proteasome_beta_archeal Archeal proteasome, beta s | 100.0 | |
| cd03755 | 207 | proteasome_alpha_type_7 proteasome_alpha_type_7. T | 100.0 | |
| cd03756 | 211 | proteasome_alpha_archeal proteasome_alpha_archeal. | 100.0 | |
| cd03749 | 211 | proteasome_alpha_type_1 proteasome_alpha_type_1. T | 100.0 | |
| TIGR03690 | 219 | 20S_bact_beta proteasome, beta subunit, bacterial | 100.0 | |
| cd03763 | 189 | proteasome_beta_type_7 proteasome beta type-7 subu | 100.0 | |
| cd01911 | 209 | proteasome_alpha proteasome alpha subunit. The 20S | 100.0 | |
| cd03754 | 215 | proteasome_alpha_type_6 proteasome_alpha_type_6. T | 100.0 | |
| cd03762 | 188 | proteasome_beta_type_6 proteasome beta type-6 subu | 100.0 | |
| cd03753 | 213 | proteasome_alpha_type_5 proteasome_alpha_type_5. T | 100.0 | |
| TIGR03691 | 228 | 20S_bact_alpha proteasome, alpha subunit, bacteria | 100.0 | |
| cd01912 | 189 | proteasome_beta proteasome beta subunit. The 20S p | 100.0 | |
| KOG0181 | 233 | consensus 20S proteasome, regulatory subunit alpha | 100.0 | |
| cd03765 | 236 | proteasome_beta_bacterial Bacterial proteasome, be | 100.0 | |
| PF00227 | 190 | Proteasome: Proteasome subunit; InterPro: IPR00135 | 100.0 | |
| KOG0185 | 256 | consensus 20S proteasome, regulatory subunit beta | 100.0 | |
| KOG0178 | 249 | consensus 20S proteasome, regulatory subunit alpha | 100.0 | |
| cd01906 | 182 | proteasome_protease_HslV proteasome_protease_HslV. | 100.0 | |
| KOG0183 | 249 | consensus 20S proteasome, regulatory subunit alpha | 100.0 | |
| KOG0184 | 254 | consensus 20S proteasome, regulatory subunit alpha | 100.0 | |
| KOG0179 | 235 | consensus 20S proteasome, regulatory subunit beta | 100.0 | |
| KOG0175 | 285 | consensus 20S proteasome, regulatory subunit beta | 100.0 | |
| KOG0177 | 200 | consensus 20S proteasome, regulatory subunit beta | 100.0 | |
| KOG0182 | 246 | consensus 20S proteasome, regulatory subunit alpha | 100.0 | |
| KOG0863 | 264 | consensus 20S proteasome, regulatory subunit alpha | 100.0 | |
| KOG0173 | 271 | consensus 20S proteasome, regulatory subunit beta | 100.0 | |
| KOG0174 | 224 | consensus 20S proteasome, regulatory subunit beta | 100.0 | |
| KOG0180 | 204 | consensus 20S proteasome, regulatory subunit beta | 100.0 | |
| PRK05456 | 172 | ATP-dependent protease subunit HslV; Provisional | 100.0 | |
| cd01913 | 171 | protease_HslV Protease HslV and the ATPase/chapero | 99.98 | |
| TIGR03692 | 171 | ATP_dep_HslV ATP-dependent protease HslVU, peptida | 99.97 | |
| cd01901 | 164 | Ntn_hydrolase The Ntn hydrolases (N-terminal nucle | 99.97 | |
| COG5405 | 178 | HslV ATP-dependent protease HslVU (ClpYQ), peptida | 99.6 | |
| COG3484 | 255 | Predicted proteasome-type protease [Posttranslatio | 99.32 | |
| PF09894 | 194 | DUF2121: Uncharacterized protein conserved in arch | 97.24 | |
| COG4079 | 293 | Uncharacterized protein conserved in archaea [Func | 95.73 | |
| KOG3361 | 157 | consensus Iron binding protein involved in Fe-S cl | 87.82 |
| >cd03750 proteasome_alpha_type_2 proteasome_alpha_type_2 | Back alignment and domain information |
|---|
Probab=100.00 E-value=6.7e-49 Score=334.83 Aligned_cols=217 Identities=21% Similarity=0.289 Sum_probs=203.0
Q ss_pred ccCCCCCC---CCCccCccccccCceEEEEEeCCEEEEEEcCCcccCceeeeCCcCeEEEecCceEEEecCChhHHHHHH
Q 026175 7 KQGLVGPN---DPIQRTQLPYVTGTSVVALKYKDGILMAADMGGSYGSTIRYKSVERIKPIGKHSLLGASGEISDFQELL 83 (242)
Q Consensus 7 ~~~~~~~~---~~~~~~~~a~~~g~t~vgi~~~dgVvlaad~r~t~~~l~~~~~~~Ki~~i~~~i~~~~sG~~~D~~~l~ 83 (242)
....|.|+ -++||+.+|+++|+|+|||+++||||||+|+|.+ ++++.+++.+||++|++|++|+++|+.+|++.+.
T Consensus 4 ~~t~fsp~Grl~QveyA~~av~~G~t~igik~~dgVvlaad~~~~-~~l~~~~~~~KI~~I~~~i~~~~sG~~~D~~~l~ 82 (227)
T cd03750 4 SLTTFSPSGKLVQIEYALAAVSSGAPSVGIKAANGVVLATEKKVP-SPLIDESSVHKVEQITPHIGMVYSGMGPDFRVLV 82 (227)
T ss_pred CCceECCCCeEhHHHHHHHHHHcCCCEEEEEeCCEEEEEEeecCC-ccccCCCCcceEEEEcCCEEEEEeEcHHhHHHHH
Confidence 34568888 4689999999999999999999999999999988 7888888999999999999999999999999999
Q ss_pred HHHHHHHHHHhhhhcCCCCCHHHHHHHHHHHH--HhhcCCCCCcceEEEEEEEECCcEEEEEECCCCceeeeCeEEEccc
Q 026175 84 RNLDELILYDNMWDDGNSLGPKELHSYLTRVM--YNRRNKFDPLWNSLVLGGVKNGQKYLGMVSMIGVNFEDSHVATGFG 161 (242)
Q Consensus 84 ~~lr~~~~~~~~~~~g~~i~~~~la~~l~~~~--~~~r~~~rP~~vs~lvaG~D~~~p~Ly~idp~G~~~~~~~~aiG~g 161 (242)
+.+|. .++.|++++|++++++.+++.|++.+ |++++++|||+|++||+|+|+.+|+||++||+|++.+++++|+|+|
T Consensus 83 ~~~r~-~~~~~~~~~~~~~~v~~la~~l~~~~~~~t~~~~~rP~~v~~li~G~D~~g~~Ly~~d~~G~~~~~~~~a~G~g 161 (227)
T cd03750 83 KKARK-IAQQYYLVYGEPIPVSQLVREIASVMQEYTQSGGVRPFGVSLLIAGWDEGGPYLYQVDPSGSYFTWKATAIGKN 161 (227)
T ss_pred HHHHH-HHHHHHHHHCCCCCHHHHHHHHHHHHHHhcCCCCCCChheEEEEEEEeCCCCEEEEECCCCCEEeeeEEEECCC
Confidence 99998 47889999999999999999999988 7778889999999999999988999999999999999999999999
Q ss_pred hHhhHHHHhhhcCCCCCHHHHHHHHHHHHHHHHhcccCCCCcEEEEEEcCC-CeEEeCCccccccc
Q 026175 162 NHLARPILRDEWHENLSYEDGVKLLEKCMRVLLYRDRSAVNKLQIAKITEE-GTTISQPYALKTFW 226 (242)
Q Consensus 162 ~~~a~~~Le~~~~~~~s~eeai~l~~~~l~~~~~~d~~s~~~i~v~ii~k~-g~~~~~~~ei~~~~ 226 (242)
+.+++++||++|+++||++||++++++||+.+.+|+ +++++++|.+|+++ |++.++++||+...
T Consensus 162 ~~~~~~~Le~~~~~~ms~eeai~l~~~~l~~~~~~~-l~~~~iev~iv~~~~~~~~~~~~ei~~~~ 226 (227)
T cd03750 162 YSNAKTFLEKRYNEDLELEDAIHTAILTLKEGFEGQ-MTEKNIEIGICGETKGFRLLTPAEIKDYL 226 (227)
T ss_pred CHHHHHHHHhhccCCCCHHHHHHHHHHHHHHHhccc-CCCCcEEEEEEECCCCEEECCHHHHHHHh
Confidence 999999999999999999999999999999998876 58899999999995 79999999987643
|
The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each. |
| >COG0638 PRE1 20S proteasome, alpha and beta subunits [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03760 proteasome_beta_type_4 proteasome beta type-4 subunit | Back alignment and domain information |
|---|
| >PRK03996 proteasome subunit alpha; Provisional | Back alignment and domain information |
|---|
| >TIGR03633 arc_protsome_A proteasome endopeptidase complex, archaeal, alpha subunit | Back alignment and domain information |
|---|
| >PTZ00246 proteasome subunit alpha; Provisional | Back alignment and domain information |
|---|
| >KOG0176 consensus 20S proteasome, regulatory subunit alpha type PSMA5/PUP2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03759 proteasome_beta_type_3 proteasome beta type-3 subunit | Back alignment and domain information |
|---|
| >cd03751 proteasome_alpha_type_3 proteasome_alpha_type_3 | Back alignment and domain information |
|---|
| >cd03761 proteasome_beta_type_5 proteasome beta type-5 subunit | Back alignment and domain information |
|---|
| >cd03757 proteasome_beta_type_1 proteasome beta type-1 subunit | Back alignment and domain information |
|---|
| >PTZ00488 Proteasome subunit beta type-5; Provisional | Back alignment and domain information |
|---|
| >cd03758 proteasome_beta_type_2 proteasome beta type-2 subunit | Back alignment and domain information |
|---|
| >TIGR03634 arc_protsome_B proteasome endopeptidase complex, archaeal, beta subunit | Back alignment and domain information |
|---|
| >cd03752 proteasome_alpha_type_4 proteasome_alpha_type_4 | Back alignment and domain information |
|---|
| >cd03764 proteasome_beta_archeal Archeal proteasome, beta subunit | Back alignment and domain information |
|---|
| >cd03755 proteasome_alpha_type_7 proteasome_alpha_type_7 | Back alignment and domain information |
|---|
| >cd03756 proteasome_alpha_archeal proteasome_alpha_archeal | Back alignment and domain information |
|---|
| >cd03749 proteasome_alpha_type_1 proteasome_alpha_type_1 | Back alignment and domain information |
|---|
| >TIGR03690 20S_bact_beta proteasome, beta subunit, bacterial type | Back alignment and domain information |
|---|
| >cd03763 proteasome_beta_type_7 proteasome beta type-7 subunit | Back alignment and domain information |
|---|
| >cd01911 proteasome_alpha proteasome alpha subunit | Back alignment and domain information |
|---|
| >cd03754 proteasome_alpha_type_6 proteasome_alpha_type_6 | Back alignment and domain information |
|---|
| >cd03762 proteasome_beta_type_6 proteasome beta type-6 subunit | Back alignment and domain information |
|---|
| >cd03753 proteasome_alpha_type_5 proteasome_alpha_type_5 | Back alignment and domain information |
|---|
| >TIGR03691 20S_bact_alpha proteasome, alpha subunit, bacterial type | Back alignment and domain information |
|---|
| >cd01912 proteasome_beta proteasome beta subunit | Back alignment and domain information |
|---|
| >KOG0181 consensus 20S proteasome, regulatory subunit alpha type PSMA2/PRE8 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03765 proteasome_beta_bacterial Bacterial proteasome, beta subunit | Back alignment and domain information |
|---|
| >PF00227 Proteasome: Proteasome subunit; InterPro: IPR001353 ATP-dependent protease complexes are present in all three kingdoms of life, where they rid the cell of misfolded or damaged proteins and control the level of certain regulatory proteins | Back alignment and domain information |
|---|
| >KOG0185 consensus 20S proteasome, regulatory subunit beta type PSMB4/PRE4 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0178 consensus 20S proteasome, regulatory subunit alpha type PSMA4/PRE9 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01906 proteasome_protease_HslV proteasome_protease_HslV | Back alignment and domain information |
|---|
| >KOG0183 consensus 20S proteasome, regulatory subunit alpha type PSMA7/PRE6 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0184 consensus 20S proteasome, regulatory subunit alpha type PSMA3/PRE10 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0179 consensus 20S proteasome, regulatory subunit beta type PSMB1/PRE7 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0175 consensus 20S proteasome, regulatory subunit beta type PSMB5/PSMB8/PRE2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0177 consensus 20S proteasome, regulatory subunit beta type PSMB2/PRE1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0182 consensus 20S proteasome, regulatory subunit alpha type PSMA6/SCL1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0863 consensus 20S proteasome, regulatory subunit alpha type PSMA1/PRE5 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0173 consensus 20S proteasome, regulatory subunit beta type PSMB7/PSMB10/PUP1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0174 consensus 20S proteasome, regulatory subunit beta type PSMB6/PSMB9/PRE3 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0180 consensus 20S proteasome, regulatory subunit beta type PSMB3/PUP3 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05456 ATP-dependent protease subunit HslV; Provisional | Back alignment and domain information |
|---|
| >cd01913 protease_HslV Protease HslV and the ATPase/chaperone HslU are part of an ATP-dependent proteolytic system that is the prokaryotic homolog of the proteasome | Back alignment and domain information |
|---|
| >TIGR03692 ATP_dep_HslV ATP-dependent protease HslVU, peptidase subunit | Back alignment and domain information |
|---|
| >cd01901 Ntn_hydrolase The Ntn hydrolases (N-terminal nucleophile) are a diverse superfamily of of enzymes that are activated autocatalytically via an N-terminally lcated nucleophilic amino acid | Back alignment and domain information |
|---|
| >COG5405 HslV ATP-dependent protease HslVU (ClpYQ), peptidase subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG3484 Predicted proteasome-type protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF09894 DUF2121: Uncharacterized protein conserved in archaea (DUF2121); InterPro: IPR016754 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >COG4079 Uncharacterized protein conserved in archaea [Function unknown] | Back alignment and domain information |
|---|
| >KOG3361 consensus Iron binding protein involved in Fe-S cluster formation [Energy production and conversion] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 242 | ||||
| 3unb_M | 219 | Mouse Constitutive 20s Proteasome In Complex With P | 2e-53 | ||
| 1iru_N | 219 | Crystal Structure Of The Mammalian 20s Proteasome A | 9e-53 | ||
| 1g0u_M | 266 | A Gated Channel Into The Proteasome Core Particle L | 2e-39 | ||
| 1ryp_N | 233 | Crystal Structure Of The 20s Proteasome From Yeast | 1e-38 | ||
| 3h4p_a | 219 | Proteasome 20s Core Particle From Methanocaldococcu | 1e-12 | ||
| 1ya7_H | 217 | Implications For Interactions Of Proteasome With Pa | 6e-09 | ||
| 1pma_B | 211 | Proteasome From Thermoplasma Acidophilum Length = 2 | 6e-09 | ||
| 3c91_H | 203 | Thermoplasma Acidophilum 20s Proteasome With An Ope | 1e-07 | ||
| 3unb_I | 205 | Mouse Constitutive 20s Proteasome In Complex With P | 1e-06 | ||
| 1iru_J | 205 | Crystal Structure Of The Mammalian 20s Proteasome A | 6e-06 | ||
| 3h4p_A | 264 | Proteasome 20s Core Particle From Methanocaldococcu | 7e-06 | ||
| 3unb_H | 234 | Mouse Constitutive 20s Proteasome In Complex With P | 5e-05 | ||
| 1ryp_K | 198 | Crystal Structure Of The 20s Proteasome From Yeast | 5e-05 | ||
| 3nzj_H | 261 | Crystal Structure Of Yeast 20s Proteasome In Comple | 8e-05 | ||
| 3unf_H | 234 | Mouse 20s Immunoproteasome In Complex With Pr-957 L | 1e-04 | ||
| 1iru_I | 234 | Crystal Structure Of The Mammalian 20s Proteasome A | 2e-04 | ||
| 3unf_K | 204 | Mouse 20s Immunoproteasome In Complex With Pr-957 L | 5e-04 | ||
| 1j2q_A | 237 | 20s Proteasome In Complex With Calpain-inhibitor I | 7e-04 |
| >pdb|3UNB|M Chain M, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 219 | Back alignment and structure |
|
| >pdb|1IRU|N Chain N, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 219 | Back alignment and structure |
| >pdb|1G0U|M Chain M, A Gated Channel Into The Proteasome Core Particle Length = 266 | Back alignment and structure |
| >pdb|1RYP|N Chain N, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 233 | Back alignment and structure |
| >pdb|3H4P|AA Chain a, Proteasome 20s Core Particle From Methanocaldococcus Jannaschii Length = 219 | Back alignment and structure |
| >pdb|1YA7|H Chain H, Implications For Interactions Of Proteasome With Pan And Pa700 From The 1.9 A Structure Of A Proteasome-11s Activator Complex Length = 217 | Back alignment and structure |
| >pdb|1PMA|B Chain B, Proteasome From Thermoplasma Acidophilum Length = 211 | Back alignment and structure |
| >pdb|3C91|H Chain H, Thermoplasma Acidophilum 20s Proteasome With An Open Gate Length = 203 | Back alignment and structure |
| >pdb|3UNB|I Chain I, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 205 | Back alignment and structure |
| >pdb|1IRU|J Chain J, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 205 | Back alignment and structure |
| >pdb|3H4P|A Chain A, Proteasome 20s Core Particle From Methanocaldococcus Jannaschii Length = 264 | Back alignment and structure |
| >pdb|3UNB|H Chain H, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 234 | Back alignment and structure |
| >pdb|1RYP|K Chain K, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 198 | Back alignment and structure |
| >pdb|3NZJ|H Chain H, Crystal Structure Of Yeast 20s Proteasome In Complex With Ligand 2a Length = 261 | Back alignment and structure |
| >pdb|3UNF|H Chain H, Mouse 20s Immunoproteasome In Complex With Pr-957 Length = 234 | Back alignment and structure |
| >pdb|1IRU|I Chain I, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 234 | Back alignment and structure |
| >pdb|3UNF|K Chain K, Mouse 20s Immunoproteasome In Complex With Pr-957 Length = 204 | Back alignment and structure |
| >pdb|1J2Q|A Chain A, 20s Proteasome In Complex With Calpain-inhibitor I From Archaeoglobus Fulgidus Length = 237 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 242 | |||
| 1iru_N | 219 | 20S proteasome; cell cycle, immune response, prote | 5e-85 | |
| 1g0u_M | 266 | Proteasome component PRE4; ubiquitin, degradation, | 6e-79 | |
| 1ryp_N | 233 | 20S proteasome; multicatalytic proteinase, protein | 8e-78 | |
| 1ryp_K | 198 | 20S proteasome; multicatalytic proteinase, protein | 7e-60 | |
| 1iru_K | 201 | 20S proteasome; cell cycle, immune response, prote | 1e-54 | |
| 1iru_I | 234 | 20S proteasome; cell cycle, immune response, prote | 2e-40 | |
| 1iru_M | 213 | 20S proteasome; cell cycle, immune response, prote | 3e-36 | |
| 1ryp_J | 204 | 20S proteasome; multicatalytic proteinase, protein | 1e-27 | |
| 3nzj_H | 261 | Proteasome component PUP1; ubiquitin, protein degr | 3e-27 | |
| 1iru_J | 205 | 20S proteasome; cell cycle, immune response, prote | 4e-27 | |
| 1ryp_M | 222 | 20S proteasome; multicatalytic proteinase, protein | 9e-26 | |
| 1ryp_H | 205 | 20S proteasome; multicatalytic proteinase, protein | 2e-25 | |
| 1iru_L | 204 | 20S proteasome; cell cycle, immune response, prote | 1e-24 | |
| 3unf_N | 199 | Proteasome subunit beta type-9; antigen presentati | 3e-24 | |
| 3nzj_K | 287 | Proteasome component PRE2; ubiquitin, protein degr | 3e-24 | |
| 1yar_H | 217 | Proteasome beta subunit; proteasome 20S, PA26 prot | 1e-23 | |
| 1ryp_L | 212 | 20S proteasome; multicatalytic proteinase, protein | 2e-23 | |
| 2jay_A | 291 | Proteasome; hydrolase; 1.99A {Mycobacterium tuberc | 4e-23 | |
| 3h4p_A | 264 | Proteasome subunit alpha; core particle, cytoplasm | 7e-23 | |
| 1ryp_I | 222 | 20S proteasome; multicatalytic proteinase, protein | 1e-22 | |
| 1j2q_H | 202 | Proteasome beta subunit; ubiquitin, CP, hydrolase; | 1e-22 | |
| 1iru_H | 205 | 20S proteasome; cell cycle, immune response, prote | 2e-22 | |
| 1q5r_H | 294 | Proteasome beta-type subunit 1; proteasome assembl | 5e-21 | |
| 3unf_H | 234 | Proteasome subunit beta type-10; antigen presentat | 3e-20 | |
| 1q5q_H | 235 | Proteasome beta-type subunit 1; proteasome assembl | 9e-19 | |
| 1q5q_A | 259 | Proteasome alpha-type subunit 1; proteasome assemb | 5e-13 | |
| 3mi0_A | 248 | Proteasome subunit alpha; enzyme inhibitors, lacto | 1e-12 | |
| 2z3b_A | 180 | ATP-dependent protease HSLV; N-terminal nucleophIl | 3e-07 | |
| 1m4y_A | 171 | ATP-dependent protease HSLV; N-terminal catalytic | 3e-06 | |
| 1iru_B | 233 | 20S proteasome; cell cycle, immune response, prote | 3e-06 | |
| 1g3k_A | 174 | ATP-dependent protease HSLV; hydrolase; 1.90A {Hae | 6e-06 | |
| 1j2p_A | 246 | Alpha-ring, proteasome alpha subunit; hydrolase; 2 | 7e-06 | |
| 1yar_A | 233 | Proteasome alpha subunit; proteasome 20S, PA26 pro | 3e-05 | |
| 1iru_G | 254 | 20S proteasome; cell cycle, immune response, prote | 3e-05 | |
| 1ryp_C | 244 | 20S proteasome; multicatalytic proteinase, protein | 1e-04 | |
| 1ryp_G | 244 | 20S proteasome; multicatalytic proteinase, protein | 1e-04 | |
| 1ryp_E | 242 | 20S proteasome; multicatalytic proteinase, protein | 2e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-04 | |
| 1iru_E | 241 | 20S proteasome; cell cycle, immune response, prote | 4e-04 |
| >1iru_N 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_M* 3une_M 3unf_M* 3unh_M Length = 219 | Back alignment and structure |
|---|
Score = 251 bits (643), Expect = 5e-85
Identities = 94/211 (44%), Positives = 147/211 (69%), Gaps = 2/211 (0%)
Query: 20 TQLPYVTGTSVVALKYKDGILMAADMGGSYGSTIRYKSVERIKPIGKHSLLGASGEISDF 79
TQ P VTGTSV+ +K++ G+++AADM GSYGS R++++ RI + ++LGASG+ +DF
Sbjct: 1 TQNPMVTGTSVLGVKFEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGASGDYADF 60
Query: 80 QELLRNLDELILYDNMWDDGNSLGPKELHSYLTRVMYNRRNKFDPLWNSLVLGGVKNGQK 139
Q L + L ++++ + + DG+S P+ +HS+LTR MY+RR+K +PLWN++V+GG +G+
Sbjct: 61 QYLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGES 120
Query: 140 YLGMVSMIGVNFEDSHVATGFGNHLARPILRD--EWHENLSYEDGVKLLEKCMRVLLYRD 197
+LG V M+GV +E +ATG+G +LA+P+LR+ E LS + L+E+CMRVL YRD
Sbjct: 121 FLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEARDLVERCMRVLYYRD 180
Query: 198 RSAVNKLQIAKITEEGTTISQPYALKTFWGF 228
+ N+ Q A +TE+G I P + +T W
Sbjct: 181 ARSYNRFQTATVTEKGVEIEGPLSTETNWDI 211
|
| >1g0u_M Proteasome component PRE4; ubiquitin, degradation, protease, NTN-hydrolase; 2.40A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 2zcy_M* 3bdm_M* 3mg6_M* 3mg7_M* 3mg8_M* 3nzj_M* 3nzw_M* 3nzx_M* Length = 266 | Back alignment and structure |
|---|
| >1ryp_N 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_N* 1jd2_M* 1g65_M 1vsy_N 1z7q_N 2f16_M* 2fak_M* 2fny_M* 2gpl_M* 3d29_M* 3dy3_M* 3dy4_M* 3e47_M* 3gpj_M* 3gpt_M* 3gpw_M* 3hye_M* 3l5q_R 3mg0_M* 3mg4_M* ... Length = 233 | Back alignment and structure |
|---|
| >1ryp_K 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_K 1g0u_J* 1jd2_J* 1g65_J 1vsy_K 1z7q_K 2f16_J* 2fak_J* 2fny_J* 2gpl_J* 2zcy_J* 3bdm_J* 3d29_J* 3dy3_J* 3dy4_J* 3e47_J* 3gpj_J* 3gpt_J* 3gpw_J* 3hye_J* ... Length = 198 | Back alignment and structure |
|---|
| >1iru_K 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_J* 3une_J 3unf_J* 3unh_J Length = 201 | Back alignment and structure |
|---|
| >1iru_I 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_H* 3une_H Length = 234 | Back alignment and structure |
|---|
| >1iru_M 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_L* 3une_L 3unf_L* 3unh_L Length = 213 | Back alignment and structure |
|---|
| >1ryp_J 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_I* 1g65_I 1vsy_J 2f16_I* 2fak_I* 2fny_I* 2gpl_I* 3d29_I* 3dy3_I* 3dy4_I* 3e47_I* 3gpj_I* 3gpt_I* 3gpw_I* 3hye_I* 3l5q_N 3mg0_I* 3mg4_I* 3oeu_I* 3oev_I* ... Length = 204 | Back alignment and structure |
|---|
| >3nzj_H Proteasome component PUP1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_H* 3nzx_H* Length = 261 | Back alignment and structure |
|---|
| >1iru_J 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_I* 3une_I 3unf_I* 3unh_I Length = 205 | Back alignment and structure |
|---|
| >1ryp_M 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_M* 1jd2_L* 1g65_L 1vsy_M 1z7q_M 2f16_L* 2fak_L* 2fny_L* 2gpl_L* 3d29_L* 3dy3_L* 3dy4_L* 3e47_L* 3gpj_L* 3gpt_L* 3gpw_L* 3hye_L* 3l5q_Q 3mg0_L* 3mg4_L* ... Length = 222 | Back alignment and structure |
|---|
| >1ryp_H 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 3nzj_N* 3nzw_N* 3nzx_N* 1vsy_H 3l5q_B 1g65_N* 1fnt_H 1g0u_N* 1jd2_N* 1z7q_H 2f16_N* 2fak_N* 2fny_N* 2gpl_N* 2zcy_N* 3bdm_N* 3d29_N* 3dy3_N* 3dy4_N* 3e47_N* ... Length = 205 | Back alignment and structure |
|---|
| >1iru_L 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_K* 3une_K 3unf_K* 3unh_K Length = 204 | Back alignment and structure |
|---|
| >3unf_N Proteasome subunit beta type-9; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_N Length = 199 | Back alignment and structure |
|---|
| >3nzj_K Proteasome component PRE2; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_K* 3nzx_K* Length = 287 | Back alignment and structure |
|---|
| >1yar_H Proteasome beta subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_H 1yau_H 3ipm_H 1pma_B 3jrm_H 3c92_H 3c91_H 3jse_H 3jtl_H Length = 217 | Back alignment and structure |
|---|
| >1ryp_L 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_L 1vsy_L 1z7q_L 3l5q_P 1g65_K* 1g0u_K* 1jd2_K* 2f16_K* 2fak_K* 2fny_K* 2gpl_K* 2zcy_K* 3bdm_K* 3d29_K* 3dy3_K* 3dy4_K* 3e47_K* 3gpj_K* 3gpt_K* 3gpw_K* ... Length = 212 | Back alignment and structure |
|---|
| >2jay_A Proteasome; hydrolase; 1.99A {Mycobacterium tuberculosis} PDB: 3mka_C 3mi0_C* 2fhg_H* 2fhh_H 3krd_C* 3mfe_G 3hfa_H* 3h6i_C 3h6f_C 3hf9_H 3mfe_H Length = 291 | Back alignment and structure |
|---|
| >3h4p_A Proteasome subunit alpha; core particle, cytoplasm, hydrolase, protease, threonine protease; 4.10A {Methanocaldococcus jannaschii} Length = 264 | Back alignment and structure |
|---|
| >1ryp_I 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1g0u_H* 1jd2_H* 1g65_H 1vsy_I 1z7q_I 2f16_H* 2fak_H* 2fny_H* 2gpl_H* 3d29_H* 3dy3_H* 3dy4_H* 3e47_H* 3gpj_H* 3gpt_H* 3gpw_H* 3hye_H* 3l5q_M 3mg0_H* 3mg4_H* ... Length = 222 | Back alignment and structure |
|---|
| >1j2q_H Proteasome beta subunit; ubiquitin, CP, hydrolase; HET: CIB; 2.83A {Archaeoglobus fulgidus} SCOP: d.153.1.4 Length = 202 | Back alignment and structure |
|---|
| >1iru_H 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_N* 3une_N Length = 205 | Back alignment and structure |
|---|
| >1q5r_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, hydrolase; 3.10A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_H Length = 294 | Back alignment and structure |
|---|
| >3unf_H Proteasome subunit beta type-10; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_H Length = 234 | Back alignment and structure |
|---|
| >1q5q_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 Length = 235 | Back alignment and structure |
|---|
| >1q5q_A Proteasome alpha-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_A 1q5r_A Length = 259 | Back alignment and structure |
|---|
| >3mi0_A Proteasome subunit alpha; enzyme inhibitors, lactones, proteasome endopeptidase comple mycobacterium tuberculosis, hydrolase; HET: SA6; 2.20A {Mycobacterium tuberculosis} PDB: 3h6f_A 3krd_A* 3h6i_A* 3mka_A 2fhh_A* 2fhg_A 3hfa_D 3hf9_A 3mfe_D Length = 248 | Back alignment and structure |
|---|
| >2z3b_A ATP-dependent protease HSLV; N-terminal nucleophIle hydrolase; 2.50A {Bacillus subtilis} SCOP: d.153.1.4 PDB: 2z3a_A 1yyf_D* 3ty6_A Length = 180 | Back alignment and structure |
|---|
| >1m4y_A ATP-dependent protease HSLV; N-terminal catalytic threonine residue, hydrolase; 2.10A {Thermotoga maritima} SCOP: d.153.1.4 Length = 171 | Back alignment and structure |
|---|
| >1iru_B 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_A* 3une_A 3unf_A* 3unh_A Length = 233 | Back alignment and structure |
|---|
| >1g3k_A ATP-dependent protease HSLV; hydrolase; 1.90A {Haemophilus influenzae} SCOP: d.153.1.4 PDB: 1g3i_G 1jjw_A 1kyi_G* 1ofh_G* 1ofi_G* 1e94_A* 1g4a_B* 1g4b_M 1hqy_A* 1ht1_C* 1ht2_A* 1ned_A Length = 174 | Back alignment and structure |
|---|
| >1j2p_A Alpha-ring, proteasome alpha subunit; hydrolase; 2.60A {Archaeoglobus fulgidus} SCOP: d.153.1.4 PDB: 1j2q_A* Length = 246 | Back alignment and structure |
|---|
| >1yar_A Proteasome alpha subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_A 1pma_A 3c91_A 3c92_A 3ipm_A 2ku1_A 2ku2_A 1yau_A 3jrm_A 3jse_A 3jtl_A Length = 233 | Back alignment and structure |
|---|
| >1iru_G 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_F* 3une_F 3unf_F* 3unh_F Length = 254 | Back alignment and structure |
|---|
| >1ryp_C 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_B* 1g65_B 2f16_B* 2fak_B* 2fny_B* 2gpl_B* 3d29_B* 3dy3_B* 3dy4_B* 3e47_B* 3gpj_B* 3gpt_B* 3gpw_B* 3hye_B* 3mg0_B* 3mg4_B* 3okj_B* 3shj_B* 3tdd_B* 3nzj_B* ... Length = 244 | Back alignment and structure |
|---|
| >1ryp_G 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_F* 1g65_F 1vsy_G 2f16_F* 2fak_F* 2fny_F* 2gpl_F* 3d29_F* 3dy3_F* 3dy4_F* 3e47_F* 3gpj_F* 3gpt_F* 3gpw_F* 3hye_F* 3l5q_L 3mg0_F* 3mg4_F* 3okj_F* 3shj_F* ... Length = 244 | Back alignment and structure |
|---|
| >1ryp_E 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_D* 1g65_D 2f16_D* 2fak_D* 2fny_D* 2gpl_D* 3d29_D* 3dy3_D* 3dy4_D* 3e47_D* 3gpj_D* 3gpt_D* 3gpw_D* 3hye_D* 3mg0_D* 3mg4_D* 3okj_D* 3shj_D* 3tdd_D* 2z5c_C ... Length = 242 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1iru_E 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_D* 3une_D 3unf_D* 3unh_D Length = 241 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 242 | |||
| 1iru_N | 219 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 1g0u_M | 266 | Proteasome component PRE4; ubiquitin, degradation, | 100.0 | |
| 1ryp_N | 233 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 1ryp_A | 243 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 1iru_B | 233 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 1yar_A | 233 | Proteasome alpha subunit; proteasome 20S, PA26 pro | 100.0 | |
| 1ryp_C | 244 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 1iru_A | 246 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 1iru_C | 261 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 1yar_H | 217 | Proteasome beta subunit; proteasome 20S, PA26 prot | 100.0 | |
| 1ryp_F | 233 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 3h4p_A | 264 | Proteasome subunit alpha; core particle, cytoplasm | 100.0 | |
| 1iru_E | 241 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 1ryp_E | 242 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 1j2q_H | 202 | Proteasome beta subunit; ubiquitin, CP, hydrolase; | 100.0 | |
| 3unf_H | 234 | Proteasome subunit beta type-10; antigen presentat | 100.0 | |
| 1iru_D | 248 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 1ryp_D | 241 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 1iru_F | 263 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 1iru_G | 254 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 1j2p_A | 246 | Alpha-ring, proteasome alpha subunit; hydrolase; 2 | 100.0 | |
| 3h4p_a | 219 | Proteasome subunit beta; core particle, cytoplasm, | 100.0 | |
| 1ryp_G | 244 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 3nzj_K | 287 | Proteasome component PRE2; ubiquitin, protein degr | 100.0 | |
| 3nzj_H | 261 | Proteasome component PUP1; ubiquitin, protein degr | 100.0 | |
| 1ryp_L | 212 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 3nzj_F | 288 | Proteasome component C1; ubiquitin, protein degrad | 100.0 | |
| 1iru_L | 204 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 1ryp_I | 222 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 1ryp_B | 250 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 1ryp_K | 198 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 1iru_M | 213 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 1iru_H | 205 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 1iru_I | 234 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 1ryp_H | 205 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 1ryp_M | 222 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 3mi0_A | 248 | Proteasome subunit alpha; enzyme inhibitors, lacto | 100.0 | |
| 1iru_K | 201 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 3unf_N | 199 | Proteasome subunit beta type-9; antigen presentati | 100.0 | |
| 1q5r_H | 294 | Proteasome beta-type subunit 1; proteasome assembl | 100.0 | |
| 1iru_J | 205 | 20S proteasome; cell cycle, immune response, prote | 100.0 | |
| 1ryp_J | 204 | 20S proteasome; multicatalytic proteinase, protein | 100.0 | |
| 1q5q_H | 235 | Proteasome beta-type subunit 1; proteasome assembl | 100.0 | |
| 1q5q_A | 259 | Proteasome alpha-type subunit 1; proteasome assemb | 100.0 | |
| 2jay_A | 291 | Proteasome; hydrolase; 1.99A {Mycobacterium tuberc | 100.0 | |
| 2z3b_A | 180 | ATP-dependent protease HSLV; N-terminal nucleophIl | 100.0 | |
| 1m4y_A | 171 | ATP-dependent protease HSLV; N-terminal catalytic | 100.0 | |
| 1g3k_A | 174 | ATP-dependent protease HSLV; hydrolase; 1.90A {Hae | 100.0 |
| >1iru_N 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_M* 3une_M 3unf_M* 3unh_M | Back alignment and structure |
|---|
Probab=100.00 E-value=4.2e-52 Score=351.22 Aligned_cols=215 Identities=44% Similarity=0.816 Sum_probs=206.7
Q ss_pred CccccccCceEEEEEeCCEEEEEEcCCcccCceeeeCCcCeEEEecCceEEEecCChhHHHHHHHHHHHHHHHHhhh-hc
Q 026175 20 TQLPYVTGTSVVALKYKDGILMAADMGGSYGSTIRYKSVERIKPIGKHSLLGASGEISDFQELLRNLDELILYDNMW-DD 98 (242)
Q Consensus 20 ~~~a~~~g~t~vgi~~~dgVvlaad~r~t~~~l~~~~~~~Ki~~i~~~i~~~~sG~~~D~~~l~~~lr~~~~~~~~~-~~ 98 (242)
+.+|+.+|+|+|||+++||||||+|+|.+.|.++.+++.+|||+|++|++++++|..+|++.|.+++|. .++.|++ ++
T Consensus 1 ~~~av~~Gtt~vgi~~~dgVvlaaD~r~~~g~~~~~~~~~Ki~~i~~~i~~~~aG~~aD~~~l~~~~~~-~~~~~~~~~~ 79 (219)
T 1iru_N 1 TQNPMVTGTSVLGVKFEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGASGDYADFQYLKQVLGQ-MVIDEELLGD 79 (219)
T ss_dssp CCSCCSEECCCEEEEETTEEEEEEECCEEETTEEEECSCCCEEEETTTEEEEEEEEHHHHHHHHHHHHH-HHHHHHHHCS
T ss_pred CCCCccCCceEEEEEeCCEEEEEECCccccCcEEecCCCCceEEeCCCEEEEeccCHHHHHHHHHHHHH-HHHHHHHHHc
Confidence 357899999999999999999999999998999999999999999999999999999999999999998 4888887 89
Q ss_pred CCCCCHHHHHHHHHHHHHhhcCCCCCcceEEEEEEEECCcEEEEEECCCCceeeeCeEEEccchHhhHHHHhhhcCC--C
Q 026175 99 GNSLGPKELHSYLTRVMYNRRNKFDPLWNSLVLGGVKNGQKYLGMVSMIGVNFEDSHVATGFGNHLARPILRDEWHE--N 176 (242)
Q Consensus 99 g~~i~~~~la~~l~~~~~~~r~~~rP~~vs~lvaG~D~~~p~Ly~idp~G~~~~~~~~aiG~g~~~a~~~Le~~~~~--~ 176 (242)
+.+++++.+|+++++.+|++|+++|||+|++||+|+|+++|+||++||+|++.+++++|+|+|+++++++||+.|++ +
T Consensus 80 ~~~~~v~~la~~l~~~ly~~r~~~~P~~v~~lvaG~D~~gp~Ly~id~~G~~~~~~~~aiGsgs~~a~~~Le~~~~~~~~ 159 (219)
T 1iru_N 80 GHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPV 159 (219)
T ss_dssp SCCCCHHHHHHHHHHHHHHHHHTTCCCCEEEEEEEEETTEEEEEEECSSCCEEECSEEECTTHHHHTHHHHHHHHTSCSC
T ss_pred CCCCCHHHHHHHHHHHHHHhcccCCCceEEEEEEEEECCCCEEEEECCCCCeEECCeEEECccHHHHHHHHHhhcCCCCC
Confidence 99999999999999999999888899999999999998899999999999999999999999999999999999999 9
Q ss_pred CCHHHHHHHHHHHHHHHHhcccCCCCcEEEEEEcCCCeEEeCCcccccccccccccCCc
Q 026175 177 LSYEDGVKLLEKCMRVLLYRDRSAVNKLQIAKITEEGTTISQPYALKTFWGFTAFQNPT 235 (242)
Q Consensus 177 ~s~eeai~l~~~~l~~~~~~d~~s~~~i~v~ii~k~g~~~~~~~ei~~~~~~~~~~~~~ 235 (242)
||++||++++++||..+.++|..++++++|++|+++|++.+++++|+.+|.+++|+++-
T Consensus 160 mt~eea~~l~~~al~~~~~~d~~sg~~i~v~vi~~~g~~~~~~~~i~~~~~~~~~~~~~ 218 (219)
T 1iru_N 160 LSQTEARDLVERCMRVLYYRDARSYNRFQTATVTEKGVEIEGPLSTETNWDIAHMISGF 218 (219)
T ss_dssp CCHHHHHHHHHHHHHHHHHHBTTCCSCEEEEEEETTEEEEEEEECCCCCCGGGGCSCC-
T ss_pred CCHHHHHHHHHHHHHHHHHhcCcCCCcEEEEEEcCCCEEEcCCeeccchhhHHHhhcCC
Confidence 99999999999999999999999999999999999999999999999999999999863
|
| >1g0u_M Proteasome component PRE4; ubiquitin, degradation, protease, NTN-hydrolase; 2.40A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 2zcy_M* 3bdm_M* 3mg6_M* 3mg7_M* 3mg8_M* 3nzj_M* 3nzw_M* 3nzx_M* | Back alignment and structure |
|---|
| >1ryp_N 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_N* 1jd2_M* 1g65_M 1vsy_N 1z7q_N 2f16_M* 2fak_M* 2fny_M* 2gpl_M* 3d29_M* 3dy3_M* 3dy4_M* 3e47_M* 3gpj_M* 3gpt_M* 3gpw_M* 3hye_M* 3l5q_R 3mg0_M* 3mg4_M* ... | Back alignment and structure |
|---|
| >1ryp_A 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_G* 1g65_G 1vsy_A 2f16_G* 2fak_G* 2fny_G* 2gpl_G* 3d29_G* 3dy3_G* 3dy4_G* 3e47_G* 3gpj_G* 3gpt_G* 3gpw_G* 3hye_G* 3l5q_A 3mg0_G* 3mg4_G* 3oeu_G* 3oev_G* ... | Back alignment and structure |
|---|
| >1iru_B 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_A* 3une_A 3unf_A* 3unh_A | Back alignment and structure |
|---|
| >1yar_A Proteasome alpha subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_A 1pma_A 3c91_A 3c92_A 3ipm_A 2ku1_A 2ku2_A 1yau_A 3jrm_A 3jse_A 3jtl_A | Back alignment and structure |
|---|
| >1ryp_C 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_B* 1g65_B 2f16_B* 2fak_B* 2fny_B* 2gpl_B* 3d29_B* 3dy3_B* 3dy4_B* 3e47_B* 3gpj_B* 3gpt_B* 3gpw_B* 3hye_B* 3mg0_B* 3mg4_B* 3okj_B* 3shj_B* 3tdd_B* 3nzj_B* ... | Back alignment and structure |
|---|
| >1iru_A 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_G* 3une_G 3unf_G* 3unh_G | Back alignment and structure |
|---|
| >1iru_C 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_B* 3une_B 3unf_B* 3unh_B | Back alignment and structure |
|---|
| >1yar_H Proteasome beta subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_H 1yau_H 3ipm_H 1pma_B 3jrm_H 3c92_H 3c91_H 3jse_H 3jtl_H | Back alignment and structure |
|---|
| >1ryp_F 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_E* 1g65_E 2f16_E* 2fak_E* 2fny_E* 2gpl_E* 3d29_E* 3dy3_E* 3dy4_E* 3e47_E* 3gpj_E* 3gpt_E* 3gpw_E* 3hye_E* 3mg0_E* 3mg4_E* 3oeu_E* 3oev_E* 3okj_E* 3shj_E* ... | Back alignment and structure |
|---|
| >3h4p_A Proteasome subunit alpha; core particle, cytoplasm, hydrolase, protease, threonine protease; 4.10A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1iru_E 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_D* 3une_D 3unf_D* 3unh_D | Back alignment and structure |
|---|
| >1ryp_E 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_D* 1g65_D 2f16_D* 2fak_D* 2fny_D* 2gpl_D* 3d29_D* 3dy3_D* 3dy4_D* 3e47_D* 3gpj_D* 3gpt_D* 3gpw_D* 3hye_D* 3mg0_D* 3mg4_D* 3okj_D* 3shj_D* 3tdd_D* 2z5c_C ... | Back alignment and structure |
|---|
| >1j2q_H Proteasome beta subunit; ubiquitin, CP, hydrolase; HET: CIB; 2.83A {Archaeoglobus fulgidus} SCOP: d.153.1.4 | Back alignment and structure |
|---|
| >3unf_H Proteasome subunit beta type-10; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_H | Back alignment and structure |
|---|
| >1iru_D 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unf_C* 3une_C* 3unh_C 3unb_C* | Back alignment and structure |
|---|
| >1ryp_D 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_C* 1g65_C 2f16_C* 2fak_C* 2fny_C* 2gpl_C* 3d29_C* 3dy3_C* 3dy4_C* 3e47_C* 3gpj_C* 3gpt_C* 3gpw_C* 3hye_C* 3mg0_C* 3mg4_C* 3oeu_C* 3oev_C* 3okj_C* 3shj_C* ... | Back alignment and structure |
|---|
| >1iru_F 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_E* 3une_E 3unf_E* 3unh_E | Back alignment and structure |
|---|
| >1iru_G 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_F* 3une_F 3unf_F* 3unh_F | Back alignment and structure |
|---|
| >1j2p_A Alpha-ring, proteasome alpha subunit; hydrolase; 2.60A {Archaeoglobus fulgidus} SCOP: d.153.1.4 PDB: 1j2q_A* | Back alignment and structure |
|---|
| >3h4p_a Proteasome subunit beta; core particle, cytoplasm, hydrolase, protease, threonine protease; 4.10A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1ryp_G 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_F* 1g65_F 1vsy_G 2f16_F* 2fak_F* 2fny_F* 2gpl_F* 3d29_F* 3dy3_F* 3dy4_F* 3e47_F* 3gpj_F* 3gpt_F* 3gpw_F* 3hye_F* 3l5q_L 3mg0_F* 3mg4_F* 3okj_F* 3shj_F* ... | Back alignment and structure |
|---|
| >3nzj_K Proteasome component PRE2; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_K* 3nzx_K* 4b4t_5 | Back alignment and structure |
|---|
| >3nzj_H Proteasome component PUP1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_H* 3nzx_H* 4b4t_2 | Back alignment and structure |
|---|
| >1ryp_L 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_L 1vsy_L 1z7q_L 3l5q_P 1g65_K* 1g0u_K* 1jd2_K* 2f16_K* 2fak_K* 2fny_K* 2gpl_K* 2zcy_K* 3bdm_K* 3d29_K* 3dy3_K* 3dy4_K* 3e47_K* 3gpj_K* 3gpt_K* 3gpw_K* ... | Back alignment and structure |
|---|
| >3nzj_F Proteasome component C1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 1z7q_G* 3nzw_F* 3nzx_F* 3un4_F* 3un8_F* 4b4t_G 4g4s_G* 3bdm_F* 1fnt_G* 2zcy_F* | Back alignment and structure |
|---|
| >1iru_L 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_K* 3une_K 3unf_K* 3unh_K | Back alignment and structure |
|---|
| >1ryp_I 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1g0u_H* 1jd2_H* 1g65_H 1vsy_I 1z7q_I 2f16_H* 2fak_H* 2fny_H* 2gpl_H* 3d29_H* 3dy3_H* 3dy4_H* 3e47_H* 3gpj_H* 3gpt_H* 3gpw_H* 3hye_H* 3l5q_M 3mg0_H* 3mg4_H* ... | Back alignment and structure |
|---|
| >1ryp_B 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_B 1g0u_A* 1jd2_A* 1g65_A 1z7q_B 2f16_A* 2fak_A* 2fny_A* 2gpl_A* 2zcy_A* 3bdm_A* 3d29_A* 3dy3_A* 3dy4_A* 3e47_A* 3gpj_A* 3gpt_A* 3gpw_A* 3hye_A* 3mg0_A* ... | Back alignment and structure |
|---|
| >1ryp_K 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_K 1g0u_J* 1jd2_J* 1g65_J 1vsy_K 1z7q_K 2f16_J* 2fak_J* 2fny_J* 2gpl_J* 2zcy_J* 3bdm_J* 3d29_J* 3dy3_J* 3dy4_J* 3e47_J* 3gpj_J* 3gpt_J* 3gpw_J* 3hye_J* ... | Back alignment and structure |
|---|
| >1iru_M 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_L* 3une_L 3unf_L* 3unh_L | Back alignment and structure |
|---|
| >1iru_H 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_N* 3une_N | Back alignment and structure |
|---|
| >1iru_I 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_H* 3une_H | Back alignment and structure |
|---|
| >1ryp_H 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 3nzj_N* 3nzw_N* 3nzx_N* 1vsy_H 3l5q_B 1g65_N* 1fnt_H 1g0u_N* 1jd2_N* 1z7q_H 2f16_N* 2fak_N* 2fny_N* 2gpl_N* 2zcy_N* 3bdm_N* 3d29_N* 3dy3_N* 3dy4_N* 3e47_N* ... | Back alignment and structure |
|---|
| >1ryp_M 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_M* 1jd2_L* 1g65_L 1vsy_M 1z7q_M 2f16_L* 2fak_L* 2fny_L* 2gpl_L* 3d29_L* 3dy3_L* 3dy4_L* 3e47_L* 3gpj_L* 3gpt_L* 3gpw_L* 3hye_L* 3l5q_Q 3mg0_L* 3mg4_L* ... | Back alignment and structure |
|---|
| >3mi0_A Proteasome subunit alpha; enzyme inhibitors, lactones, proteasome endopeptidase comple mycobacterium tuberculosis, hydrolase; HET: SA6; 2.20A {Mycobacterium tuberculosis} SCOP: d.153.1.4 PDB: 3h6f_A 3krd_A* 3h6i_A* 3mka_A 2fhh_A* 2fhg_A 3hfa_D 3hf9_A 3mfe_D | Back alignment and structure |
|---|
| >1iru_K 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_J* 3une_J 3unf_J* 3unh_J | Back alignment and structure |
|---|
| >3unf_N Proteasome subunit beta type-9; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_N | Back alignment and structure |
|---|
| >1q5r_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, hydrolase; 3.10A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_H | Back alignment and structure |
|---|
| >1iru_J 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_I* 3une_I 3unf_I* 3unh_I | Back alignment and structure |
|---|
| >1ryp_J 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_I* 1g65_I 1vsy_J 2f16_I* 2fak_I* 2fny_I* 2gpl_I* 3d29_I* 3dy3_I* 3dy4_I* 3e47_I* 3gpj_I* 3gpt_I* 3gpw_I* 3hye_I* 3l5q_N 3mg0_I* 3mg4_I* 3oeu_I* 3oev_I* ... | Back alignment and structure |
|---|
| >1q5q_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 | Back alignment and structure |
|---|
| >1q5q_A Proteasome alpha-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_A 1q5r_A | Back alignment and structure |
|---|
| >2jay_A Proteasome; hydrolase; 1.99A {Mycobacterium tuberculosis} PDB: 3mka_C 3mi0_C* 2fhg_H* 2fhh_H 3krd_C* 3mfe_G 3hfa_H* 3h6i_C 3h6f_C 3hf9_H 3mfe_H | Back alignment and structure |
|---|
| >2z3b_A ATP-dependent protease HSLV; N-terminal nucleophIle hydrolase; 2.50A {Bacillus subtilis} SCOP: d.153.1.4 PDB: 2z3a_A 1yyf_D* 3ty6_A | Back alignment and structure |
|---|
| >1m4y_A ATP-dependent protease HSLV; N-terminal catalytic threonine residue, hydrolase; 2.10A {Thermotoga maritima} SCOP: d.153.1.4 | Back alignment and structure |
|---|
| >1g3k_A ATP-dependent protease HSLV; hydrolase; 1.90A {Haemophilus influenzae} SCOP: d.153.1.4 PDB: 1g3i_G 1jjw_A 1kyi_G* 1ofh_G* 1ofi_G* 1e94_A* 1g4a_B* 1g4b_M 1hqy_A* 1ht1_C* 1ht2_A* 1ned_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 242 | ||||
| d1iru2_ | 217 | d.153.1.4 (2:) Proteasome beta subunit (catalytic) | 7e-53 | |
| d1ryp2_ | 233 | d.153.1.4 (2:) Proteasome beta subunit (catalytic) | 5e-48 | |
| d1irui_ | 220 | d.153.1.4 (I:) Proteasome beta subunit (catalytic) | 8e-36 | |
| d1rypk_ | 198 | d.153.1.4 (K:) Proteasome beta subunit (catalytic) | 1e-35 | |
| d1rypi_ | 222 | d.153.1.4 (I:) Proteasome beta subunit (catalytic) | 1e-34 | |
| d1irul_ | 201 | d.153.1.4 (L:) Proteasome beta subunit (catalytic) | 3e-32 | |
| d1ryp1_ | 222 | d.153.1.4 (1:) Proteasome beta subunit (catalytic) | 4e-32 | |
| d1iruh_ | 202 | d.153.1.4 (H:) Proteasome beta subunit (catalytic) | 7e-32 | |
| d1j2qh_ | 202 | d.153.1.4 (H:) Proteasome beta subunit (catalytic) | 7e-31 | |
| d1iruk_ | 199 | d.153.1.4 (K:) Proteasome beta subunit (catalytic) | 9e-31 | |
| d1rypl_ | 212 | d.153.1.4 (L:) Proteasome beta subunit (catalytic) | 1e-30 | |
| d1iruj_ | 204 | d.153.1.4 (J:) Proteasome beta subunit (catalytic) | 1e-30 | |
| d1ryph_ | 205 | d.153.1.4 (H:) Proteasome beta subunit (catalytic) | 3e-30 | |
| d1rypc_ | 244 | d.153.1.4 (C:) Proteasome alpha subunit (non-catal | 3e-29 | |
| d1irue_ | 234 | d.153.1.4 (E:) Proteasome alpha subunit (non-catal | 4e-29 | |
| d1yarh1 | 203 | d.153.1.4 (H:1-203) Proteasome beta subunit (catal | 9e-29 | |
| d1j2pa_ | 243 | d.153.1.4 (A:) Proteasome alpha subunit (non-catal | 4e-28 | |
| d1rypg_ | 244 | d.153.1.4 (G:) Proteasome alpha subunit (non-catal | 9e-28 | |
| d1rypj_ | 204 | d.153.1.4 (J:) Proteasome beta subunit (catalytic) | 1e-27 | |
| d1q5qh_ | 224 | d.153.1.4 (H:) Proteasome beta subunit (catalytic) | 2e-27 | |
| d1rypb_ | 250 | d.153.1.4 (B:) Proteasome alpha subunit (non-catal | 3e-27 | |
| d1iruc_ | 250 | d.153.1.4 (C:) Proteasome alpha subunit (non-catal | 4e-27 | |
| d1yara1 | 221 | d.153.1.4 (A:13-233) Proteasome alpha subunit (non | 7e-27 | |
| d1irub_ | 233 | d.153.1.4 (B:) Proteasome alpha subunit (non-catal | 9e-27 | |
| d1iru1_ | 213 | d.153.1.4 (1:) Proteasome beta subunit (catalytic) | 2e-26 | |
| d1irug_ | 245 | d.153.1.4 (G:) Proteasome alpha subunit (non-catal | 2e-26 | |
| d1rypd_ | 241 | d.153.1.4 (D:) Proteasome alpha subunit (non-catal | 7e-26 | |
| d1rype_ | 242 | d.153.1.4 (E:) Proteasome alpha subunit (non-catal | 1e-24 | |
| d1iruf_ | 238 | d.153.1.4 (F:) Proteasome alpha subunit (non-catal | 3e-24 | |
| d1irud_ | 243 | d.153.1.4 (D:) Proteasome alpha subunit (non-catal | 6e-23 | |
| d1q5qa_ | 227 | d.153.1.4 (A:) Proteasome alpha subunit (non-catal | 9e-23 | |
| d1rypa_ | 243 | d.153.1.4 (A:) Proteasome alpha subunit (non-catal | 3e-22 | |
| d1rypf_ | 233 | d.153.1.4 (F:) Proteasome alpha subunit (non-catal | 1e-21 | |
| d1m4ya_ | 171 | d.153.1.4 (A:) HslV (ClpQ) protease {Thermotoga ma | 4e-19 | |
| d1irua_ | 244 | d.153.1.4 (A:) Proteasome alpha subunit (non-catal | 4e-18 | |
| d2z3ba1 | 180 | d.153.1.4 (A:1-180) HslV (ClpQ) protease {Bacillus | 8e-18 | |
| d1g3ka_ | 173 | d.153.1.4 (A:) HslV (ClpQ) protease {Haemophilus i | 2e-15 |
| >d1iru2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 217 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ntn hydrolase-like superfamily: N-terminal nucleophile aminohydrolases (Ntn hydrolases) family: Proteasome subunits domain: Proteasome beta subunit (catalytic) species: Cow (Bos taurus) [TaxId: 9913]
Score = 168 bits (426), Expect = 7e-53
Identities = 93/211 (44%), Positives = 146/211 (69%), Gaps = 2/211 (0%)
Query: 20 TQLPYVTGTSVVALKYKDGILMAADMGGSYGSTIRYKSVERIKPIGKHSLLGASGEISDF 79
TQ P VTGTSV+ +K++ G+++AADM GSYGS R++++ RI + ++LGASG+ +DF
Sbjct: 1 TQNPMVTGTSVLGVKFEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGASGDYADF 60
Query: 80 QELLRNLDELILYDNMWDDGNSLGPKELHSYLTRVMYNRRNKFDPLWNSLVLGGVKNGQK 139
Q L + L ++++ + + DG+S P+ +HS+LTR MY+RR+K +PLWN++V+GG +G+
Sbjct: 61 QYLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGES 120
Query: 140 YLGMVSMIGVNFEDSHVATGFGNHLARPILRDE--WHENLSYEDGVKLLEKCMRVLLYRD 197
+LG V M+GV +E +ATG+G +LA+P+LR+ LS + L+E+CMRVL YRD
Sbjct: 121 FLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEARDLVERCMRVLYYRD 180
Query: 198 RSAVNKLQIAKITEEGTTISQPYALKTFWGF 228
+ N+ Q A +TE+G I P + +T W
Sbjct: 181 ARSYNRFQTATVTEKGVEIEGPLSTETNWDI 211
|
| >d1ryp2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 | Back information, alignment and structure |
|---|
| >d1irui_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 220 | Back information, alignment and structure |
|---|
| >d1rypk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 198 | Back information, alignment and structure |
|---|
| >d1rypi_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 222 | Back information, alignment and structure |
|---|
| >d1irul_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 201 | Back information, alignment and structure |
|---|
| >d1ryp1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 222 | Back information, alignment and structure |
|---|
| >d1iruh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 202 | Back information, alignment and structure |
|---|
| >d1j2qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 | Back information, alignment and structure |
|---|
| >d1iruk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 199 | Back information, alignment and structure |
|---|
| >d1rypl_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 | Back information, alignment and structure |
|---|
| >d1iruj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 204 | Back information, alignment and structure |
|---|
| >d1ryph_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 205 | Back information, alignment and structure |
|---|
| >d1rypc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 244 | Back information, alignment and structure |
|---|
| >d1irue_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 234 | Back information, alignment and structure |
|---|
| >d1yarh1 d.153.1.4 (H:1-203) Proteasome beta subunit (catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 203 | Back information, alignment and structure |
|---|
| >d1j2pa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 243 | Back information, alignment and structure |
|---|
| >d1rypg_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 244 | Back information, alignment and structure |
|---|
| >d1rypj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 204 | Back information, alignment and structure |
|---|
| >d1q5qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Rhodococcus erythropolis [TaxId: 1833]} Length = 224 | Back information, alignment and structure |
|---|
| >d1rypb_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 250 | Back information, alignment and structure |
|---|
| >d1iruc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 250 | Back information, alignment and structure |
|---|
| >d1yara1 d.153.1.4 (A:13-233) Proteasome alpha subunit (non-catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 221 | Back information, alignment and structure |
|---|
| >d1irub_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 233 | Back information, alignment and structure |
|---|
| >d1iru1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 213 | Back information, alignment and structure |
|---|
| >d1irug_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 245 | Back information, alignment and structure |
|---|
| >d1rypd_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 241 | Back information, alignment and structure |
|---|
| >d1rype_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 242 | Back information, alignment and structure |
|---|
| >d1iruf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 238 | Back information, alignment and structure |
|---|
| >d1irud_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 243 | Back information, alignment and structure |
|---|
| >d1q5qa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Rhodococcus erythropolis [TaxId: 1833]} Length = 227 | Back information, alignment and structure |
|---|
| >d1rypa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 243 | Back information, alignment and structure |
|---|
| >d1rypf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 | Back information, alignment and structure |
|---|
| >d1m4ya_ d.153.1.4 (A:) HslV (ClpQ) protease {Thermotoga maritima [TaxId: 2336]} Length = 171 | Back information, alignment and structure |
|---|
| >d1irua_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 244 | Back information, alignment and structure |
|---|
| >d2z3ba1 d.153.1.4 (A:1-180) HslV (ClpQ) protease {Bacillus subtilis [TaxId: 1423]} Length = 180 | Back information, alignment and structure |
|---|
| >d1g3ka_ d.153.1.4 (A:) HslV (ClpQ) protease {Haemophilus influenzae [TaxId: 727]} Length = 173 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 242 | |||
| d1iru2_ | 217 | Proteasome beta subunit (catalytic) {Cow (Bos taur | 100.0 | |
| d1iruc_ | 250 | Proteasome alpha subunit (non-catalytic) {Cow (Bos | 100.0 | |
| d1yara1 | 221 | Proteasome alpha subunit (non-catalytic) {Archaeon | 100.0 | |
| d1irul_ | 201 | Proteasome beta subunit (catalytic) {Cow (Bos taur | 100.0 | |
| d1rypk_ | 198 | Proteasome beta subunit (catalytic) {Baker's yeast | 100.0 | |
| d1irue_ | 234 | Proteasome alpha subunit (non-catalytic) {Cow (Bos | 100.0 | |
| d1rypf_ | 233 | Proteasome alpha subunit (non-catalytic) {Baker's | 100.0 | |
| d1rypc_ | 244 | Proteasome alpha subunit (non-catalytic) {Baker's | 100.0 | |
| d1ryp2_ | 233 | Proteasome beta subunit (catalytic) {Baker's yeast | 100.0 | |
| d1rypb_ | 250 | Proteasome alpha subunit (non-catalytic) {Baker's | 100.0 | |
| d1rypa_ | 243 | Proteasome alpha subunit (non-catalytic) {Baker's | 100.0 | |
| d1irua_ | 244 | Proteasome alpha subunit (non-catalytic) {Cow (Bos | 100.0 | |
| d1rypl_ | 212 | Proteasome beta subunit (catalytic) {Baker's yeast | 100.0 | |
| d1j2pa_ | 243 | Proteasome alpha subunit (non-catalytic) {Archaeon | 100.0 | |
| d1irug_ | 245 | Proteasome alpha subunit (non-catalytic) {Cow (Bos | 100.0 | |
| d1iruf_ | 238 | Proteasome alpha subunit (non-catalytic) {Cow (Bos | 100.0 | |
| d1ryph_ | 205 | Proteasome beta subunit (catalytic) {Baker's yeast | 100.0 | |
| d1irui_ | 220 | Proteasome beta subunit (catalytic) {Cow (Bos taur | 100.0 | |
| d1irub_ | 233 | Proteasome alpha subunit (non-catalytic) {Cow (Bos | 100.0 | |
| d1iruh_ | 202 | Proteasome beta subunit (catalytic) {Cow (Bos taur | 100.0 | |
| d1yarh1 | 203 | Proteasome beta subunit (catalytic) {Archaeon Ther | 100.0 | |
| d1irud_ | 243 | Proteasome alpha subunit (non-catalytic) {Cow (Bos | 100.0 | |
| d1rypg_ | 244 | Proteasome alpha subunit (non-catalytic) {Baker's | 100.0 | |
| d1j2qh_ | 202 | Proteasome beta subunit (catalytic) {Archaeon Arch | 100.0 | |
| d1rype_ | 242 | Proteasome alpha subunit (non-catalytic) {Baker's | 100.0 | |
| d1rypd_ | 241 | Proteasome alpha subunit (non-catalytic) {Baker's | 100.0 | |
| d1rypi_ | 222 | Proteasome beta subunit (catalytic) {Baker's yeast | 100.0 | |
| d1ryp1_ | 222 | Proteasome beta subunit (catalytic) {Baker's yeast | 100.0 | |
| d1q5qa_ | 227 | Proteasome alpha subunit (non-catalytic) {Rhodococ | 100.0 | |
| d1iruk_ | 199 | Proteasome beta subunit (catalytic) {Cow (Bos taur | 100.0 | |
| d1iruj_ | 204 | Proteasome beta subunit (catalytic) {Cow (Bos taur | 100.0 | |
| d1rypj_ | 204 | Proteasome beta subunit (catalytic) {Baker's yeast | 100.0 | |
| d1iru1_ | 213 | Proteasome beta subunit (catalytic) {Cow (Bos taur | 100.0 | |
| d1q5qh_ | 224 | Proteasome beta subunit (catalytic) {Rhodococcus e | 100.0 | |
| d2z3ba1 | 180 | HslV (ClpQ) protease {Bacillus subtilis [TaxId: 14 | 99.94 | |
| d1m4ya_ | 171 | HslV (ClpQ) protease {Thermotoga maritima [TaxId: | 99.93 | |
| d1g3ka_ | 173 | HslV (ClpQ) protease {Haemophilus influenzae [TaxI | 99.92 |
| >d1iru2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ntn hydrolase-like superfamily: N-terminal nucleophile aminohydrolases (Ntn hydrolases) family: Proteasome subunits domain: Proteasome beta subunit (catalytic) species: Cow (Bos taurus) [TaxId: 9913]
Probab=100.00 E-value=8.2e-49 Score=328.54 Aligned_cols=213 Identities=43% Similarity=0.831 Sum_probs=200.8
Q ss_pred ccccccCceEEEEEeCCEEEEEEcCCcccCceeeeCCcCeEEEecCceEEEecCChhHHHHHHHHHHHHHHHHhhhhcCC
Q 026175 21 QLPYVTGTSVVALKYKDGILMAADMGGSYGSTIRYKSVERIKPIGKHSLLGASGEISDFQELLRNLDELILYDNMWDDGN 100 (242)
Q Consensus 21 ~~a~~~g~t~vgi~~~dgVvlaad~r~t~~~l~~~~~~~Ki~~i~~~i~~~~sG~~~D~~~l~~~lr~~~~~~~~~~~g~ 100 (242)
.+|+.+|+|+|||+++||||||+|+|++.+.++..++.+||++|+++++++++|..+|++.+.++++++..+++...++.
T Consensus 2 ~~~~~~GtTivgi~~~dgVviaaD~r~t~g~~~~~~~~~KI~~i~~~i~~~~sG~~aD~~~l~~~~~~~~~~~~~~~~~~ 81 (217)
T d1iru2_ 2 QNPMVTGTSVLGVKFEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGASGDYADFQYLKQVLGQMVIDEELLGDGH 81 (217)
T ss_dssp CSCCSEECCCEEEEETTEEEEEEECCEEETTEEEECSCCCEEEETTTEEEEEEEEHHHHHHHHHHHHHHHHHHHHHCSSC
T ss_pred CCCcCcccEEEEEEECCEEEEEEcCCcccCCeeecCCcceEEEeCCCeEEEeccccHHHHHHHHHHHHHHHHhhhhcCCC
Confidence 46889999999999999999999999999999999999999999999999999999999999999987543444456789
Q ss_pred CCCHHHHHHHHHHHHHhhcCCCCCcceEEEEEEEECCcEEEEEECCCCceeeeCeEEEccchHhhHHHHhhhcC--CCCC
Q 026175 101 SLGPKELHSYLTRVMYNRRNKFDPLWNSLVLGGVKNGQKYLGMVSMIGVNFEDSHVATGFGNHLARPILRDEWH--ENLS 178 (242)
Q Consensus 101 ~i~~~~la~~l~~~~~~~r~~~rP~~vs~lvaG~D~~~p~Ly~idp~G~~~~~~~~aiG~g~~~a~~~Le~~~~--~~~s 178 (242)
+++++.+++++++.+|+++..++|+++++|++|+|+++|+||.+||+|++.+++++|+|+|+.+++++|++.|+ ++||
T Consensus 82 ~~~v~~~a~~l~~~~y~~~~~~~p~~~~~li~G~d~~~~~l~~~D~~G~~~~~~~~a~G~g~~~a~~~Le~~~~~~~~lt 161 (217)
T d1iru2_ 82 SYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVLS 161 (217)
T ss_dssp CCCHHHHHHHHHHHHHHHHHTTCCCCEEEEEEEEETTEEEEEEECSSCCEEECSEEECTTHHHHTHHHHHHHHTSCSCCC
T ss_pred CCCHHHHHHHHHHHHHHhccccCcccceEEEEEEcCCCcEEEEEecCceeEeeeEEeccCcHHHHHHHHHHHhcccCCCC
Confidence 99999999999999999987789999999999999999999999999999999999999999999999999765 8999
Q ss_pred HHHHHHHHHHHHHHHHhcccCCCCcEEEEEEcCCCeEEeCCcccccccccccccC
Q 026175 179 YEDGVKLLEKCMRVLLYRDRSAVNKLQIAKITEEGTTISQPYALKTFWGFTAFQN 233 (242)
Q Consensus 179 ~eeai~l~~~~l~~~~~~d~~s~~~i~v~ii~k~g~~~~~~~ei~~~~~~~~~~~ 233 (242)
.+||++++++||+.+.+||..++++++|++|+++|++++.|++++..|+++++++
T Consensus 162 ~~ea~~l~~~al~~a~~rd~~sg~~i~i~vi~~~G~~~~~~~~~~~~~~~a~~~~ 216 (217)
T d1iru2_ 162 QTEARDLVERCMRVLYYRDARSYNRFQTATVTEKGVEIEGPLSTETNWDIAHMIS 216 (217)
T ss_dssp HHHHHHHHHHHHHHHHHHBTTCCSCEEEEEEETTEEEEEEEECCCCCCGGGGCSC
T ss_pred HHHHHHHHHHHHHHHHHhcCcCCCcEEEEEEeCCCEEEcCCeeccccHHHHhhcC
Confidence 9999999999999999999999999999999999999999999999999999875
|
| >d1iruc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1yara1 d.153.1.4 (A:13-233) Proteasome alpha subunit (non-catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1irul_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1rypk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1irue_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1rypf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rypc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ryp2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rypb_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rypa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1irua_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1rypl_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1j2pa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1irug_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1iruf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ryph_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1irui_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1irub_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1iruh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1yarh1 d.153.1.4 (H:1-203) Proteasome beta subunit (catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1irud_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1rypg_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1j2qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1rype_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rypd_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rypi_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ryp1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1q5qa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Rhodococcus erythropolis [TaxId: 1833]} | Back information, alignment and structure |
|---|
| >d1iruk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1iruj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1rypj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iru1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1q5qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Rhodococcus erythropolis [TaxId: 1833]} | Back information, alignment and structure |
|---|
| >d2z3ba1 d.153.1.4 (A:1-180) HslV (ClpQ) protease {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1m4ya_ d.153.1.4 (A:) HslV (ClpQ) protease {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1g3ka_ d.153.1.4 (A:) HslV (ClpQ) protease {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|