Citrus Sinensis ID: 026176


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240--
MHKLSRSNRDKLQQFVSITGASEKAALQALKASDWHLEGAFDVFYSQPQSKSLTDTRHLEELYNRYKDPYLDMILVDGITLLCNDLQVDPQDIVMLVVSWHMKAATMCEFSKQEFIGGLQSLGIDSLDKFRERISFMRAELKDEQKFREIYNFAFAWAKEKGQKSLALDTAIGMWQLLFAEKQWPLVDHWCQFLQAKHNKAISRDTWSQLLEFARVRQWTLHYQTMMQKAHGLILLMNSLNT
ccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccccHHHHHHccccccccccHHHHHHHHHHHcccccccccHHHHHHHHHHcccccccHHHHHHHHHccccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHHcccc
****************SITGASEKAALQALKASDWHLEGAFDVFYSQ*****LTDTRHLEELYNRYKDPYLDMILVDGITLLCNDLQVDPQDIVMLVVSWHMKAATMCEFSKQEFIGGLQSLGIDSLDKFRERISFMRAELKDEQKFREIYNFAFAWAKEKGQKSLALDTAIGMWQLLFAEKQWPLVDHWCQFLQAKHNKAISRDTWSQLLEFARVRQWTLHYQTMMQKAHGLILLMNSLN*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHKLSRSNRDKLQQFVSITGASEKAALQALKASDWHLEGAFDVFYSQPQSKSLTDTRHLEELYNRYKDPYLDMILVDGITLLCNDLQVDPQDIVMLVVSWHMKAATMCEFSKQEFIGGLQSLGIDSLDKFRERISFMRAELKDEQKFREIYNFAFAWAKEKGQKSLALDTAIGMWQLLFAEKQWPLVDHWCQFLQAKHNKAISRDTWSQLLEFARVRQWTLHYQTMMQKAHGLILLMNSLNT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DCN1-like protein 2 May contribute to neddylation of cullin components of SCF-type E3 ubiquitin ligase complexes. Neddylation of cullins play an essential role in the regulation of SCF-type complexes activity.probableQ8BZJ7
DCN1-like protein 1 Part of an E3 ubiquitin ligase complex for neddylation. Required for neddylation of cullin components of E3 cullin-RING ubiquitin ligase complexes by enhancing the rate of cullins neddylation.probableQ5ZKU1
DCN1-like protein 2 May contribute to neddylation of cullin components of SCF-type E3 ubiquitin ligase complexes. Neddylation of cullins play an essential role in the regulation of SCF-type complexes activity.probableQ6PH85

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3TDU, chain A
Confidence level:very confident
Coverage over the Query: 55-234
View the alignment between query and template
View the model in PyMOL
Template: 3BQ3, chain A
Confidence level:very confident
Coverage over the Query: 6-234
View the alignment between query and template
View the model in PyMOL