Citrus Sinensis ID: 026212


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-
MGSESSASLDEEVNVMVVDASVDGHCPTKKNKSRVPKRVHKAEREKLKREHLNDLFLDLANAVEVNQPNNGKACVLNEAARLLKDLFSQIESLNKENASLLSESHYVTIEKNELKEENSSLESQIEVLQSELRARVVQSKPDLNIPPEFQQPELSSHFPGDSYGFPAAVEPTLSQAPAVLVVPIHSDLQAYSASDVAQLTSKPASNVSKPHARYPNPADSWPSQLLGENISSTRENADRNK
cccccccccHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccc
***************************************************LNDLFLDLANAVEVNQPNNGKACVLNEAARLLKDLFSQIES***************************************************************************AV**TLSQAPAVLVVPIHSDLQAY**************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSESSASLDEEVNVMVVDASVDGHCPTKKNKSRVPKRVHKAEREKLKREHLNDLFLDLANAVEVNQPNNGKACVxxxxxxxxxxxxxxxxxxxxxxxxxxxxSHYVTIExxxxxxxxxxxxxxxxxxxxxLRARVVQSKPDLNIPPEFQQPELSSHFPGDSYGFPAAVEPTLSQAPAVLVVPIHSDLQAYSASDVAQLTSKPASNVSKPHARYPNPADSWPSQLLGENISSTRENADRNK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transcription factor bHLH47 probableQ9SN74

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1NKP, chain A
Confidence level:confident
Coverage over the Query: 37-96,111-128
View the alignment between query and template
View the model in PyMOL
Template: 3A7P, chain A
Confidence level:probable
Coverage over the Query: 70-134
View the alignment between query and template
View the model in PyMOL