Citrus Sinensis ID: 026212

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-
MGSESSASLDEEVNVMVVDASVDGHCPTKKNKSRVPKRVHKAEREKLKREHLNDLFLDLANAVEVNQPNNGKACVLNEAARLLKDLFSQIESLNKENASLLSESHYVTIEKNELKEENSSLESQIEVLQSELRARVVQSKPDLNIPPEFQQPELSSHFPGDSYGFPAAVEPTLSQAPAVLVVPIHSDLQAYSASDVAQLTSKPASNVSKPHARYPNPADSWPSQLLGENISSTRENADRNK
ccccccccHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccc
ccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccc
mgsessasldeEVNVMVVDasvdghcptkknksrvpkrVHKAEREKLKREHLNDLFLDLANAvevnqpnngkaCVLNEAARLLKDLFSQIESLNKENASLLSESHYVTIEKNELKEENSSLESQIEVLQSELRARVvqskpdlnippefqqpelsshfpgdsygfpaaveptlsqapavlvvpihsdlqaysasdvaqltskpasnvskpharypnpadswpsqllgenisstrenadrnk
mgsessasldeeVNVMVVDasvdghcptkknksrvpkrvhKAEREKLKREHLNDLFLDLANAVEVNQPNNGKACVLNEAARLLKDLFSQIESLNKENASLLSESHYVTIEKNELKEENSSLESQIEVLQSELRARVVQSKPDLNIPPEFQQPELSSHFPGDSYGFPAAVEPTLSQAPAVLVVPIHSDLQAYSASDVAQLTSKPASNVSKPHARYPNpadswpsqllgenisstrenadrnk
MGSESSASLDEEVNVMVVDASVDGHCPTKKNKSRVPKRVHKAEREKLKREHLNDLFLDLANAVEVNQPNNGKACVLNEAARLLKDLFSQIESLNKENASLLSESHYVTIeknelkeensslesQIEVLQSELRARVVQSKPDLNIPPEFQQPELSSHFPGDSYGFPAAVEPTLSQAPAVLVVPIHSDLQAYSASDVAQLTSKPASNVSKPHARYPNPADSWPSQLLGENISSTRENADRNK
***************************************************LNDLFLDLANAVEVNQPNNGKACVLNEAARLLKDLFSQIES***************************************************************************AV**TLSQAPAVLVVPIHSDLQAY**************************************************
*****************************************************DLFLDLANAVE******GKACVLNEAARLLKDLFS*********************************************************************************************************************************************************
**********EEVNVMVVDASVDGHCP**************AEREKLKREHLNDLFLDLANAVEVNQPNNGKACVLNEAARLLKDLFSQIESLNKENASLLSESHYVTIEKN***********QIEVLQSELRARVVQSKPDLNIPPEFQQPELSSHFPGDSYGFPAAVEPTLSQAPAVLVVPIHSDLQAYSASDVAQLTSKPASNVSKPHARYPNPADSWPSQLLGENISS*********
******************************************E*EKLKREHLNDLFLDLANAVEVNQPNNGKACVLNEAARLLKDLFSQIESLNKENASLLSESHYVTIEKNELKEENSSLESQIEVLQSELRARVVQSKPDLNIPPEFQQPELSSHFPGDSYGFPAAVEPTLSQAPAVLVVPIHSDLQAYS**************************DSWP***L***************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSESSASLDEEVNVMVVDASVDGHCPTKKNKSRVPKRVHKAEREKLKREHLNDLFLDLANAVEVNQPNNGKACVxxxxxxxxxxxxxxxxxxxxxxxxxxxxSHYVTIExxxxxxxxxxxxxxxxxxxxxLRARVVQSKPDLNIPPEFQQPELSSHFPGDSYGFPAAVEPTLSQAPAVLVVPIHSDLQAYSASDVAQLTSKPASNVSKPHARYPNPADSWPSQLLGENISSTRENADRNK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query241 2.2.26 [Sep-21-2011]
Q9SN74240 Transcription factor bHLH yes no 0.871 0.875 0.506 4e-50
Q8W2F2286 Transcription factor bHLH no no 0.547 0.461 0.364 2e-16
Q9LT23337 Transcription factor bHLH no no 0.435 0.311 0.409 3e-15
Q9FH37234 Transcription factor ILR3 no no 0.643 0.662 0.318 2e-11
Q9LTC7320 Transcription factor bHLH no no 0.668 0.503 0.303 4e-11
Q8L467283 Transcription factor bHLH no no 0.585 0.498 0.317 2e-09
Q9C682226 Transcription factor bHLH no no 0.543 0.579 0.304 4e-08
>sp|Q9SN74|BH047_ARATH Transcription factor bHLH47 OS=Arabidopsis thaliana GN=BHLH47 PE=2 SV=1 Back     alignment and function desciption
 Score =  198 bits (503), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 118/233 (50%), Positives = 150/233 (64%), Gaps = 23/233 (9%)

Query: 18  VDASVDGHCPTKKNKSRVPKRVHKAEREKLKREHLNDLFLDLANAVEVNQPNNGKACVLN 77
            +A+ D  C     K +VPKR++KA RE+LKREHLN+LF++LA+ +E+NQ N+GKA +L 
Sbjct: 13  ANATADERC----RKGKVPKRINKAVRERLKREHLNELFIELADTLELNQQNSGKASILC 68

Query: 78  EAARLLKDLFSQIESLNKENASLLSESHYVTIEKNELKEENSSLESQIEVLQSELRARVV 137
           EA R LKD+F QIESL KE+ASLLSES YVT EKNELKEE S LE++I  LQ+E+ AR  
Sbjct: 69  EATRFLKDVFGQIESLRKEHASLLSESSYVTTEKNELKEETSVLETEISKLQNEIEARAN 128

Query: 138 QSKPDLNIPP---------EFQQPELSSHFPG----DSYGFPAAVEPTLSQAPAVLVVPI 184
           QSKPDLN  P         + Q PE  S FPG       GF  +   TL     VLV+PI
Sbjct: 129 QSKPDLNTSPAPEYHHHHYQQQHPERVSQFPGLPIFQGPGFQQSAT-TLHPPATVLVLPI 187

Query: 185 HSDLQAYSASDVAQLTSKP----ASNVSKPHARYPNPADSWPSQLLGENISST 233
             D Q    S++ Q   +P    +SNVSKP  RY + ADSW S+LLGE + ++
Sbjct: 188 QPDPQTQDISEMTQ-AQQPLMFNSSNVSKPCPRYASAADSWSSRLLGERLKAS 239

Arabidopsis thaliana (taxid: 3702)
>sp|Q8W2F2|BH011_ARATH Transcription factor bHLH11 OS=Arabidopsis thaliana GN=BHLH11 PE=2 SV=2 Back     alignment and function description
>sp|Q9LT23|BH121_ARATH Transcription factor bHLH121 OS=Arabidopsis thaliana GN=BHLH121 PE=2 SV=1 Back     alignment and function description
>sp|Q9FH37|ILR3_ARATH Transcription factor ILR3 OS=Arabidopsis thaliana GN=ILR3 PE=1 SV=1 Back     alignment and function description
>sp|Q9LTC7|BH034_ARATH Transcription factor bHLH34 OS=Arabidopsis thaliana GN=BHLH34 PE=2 SV=1 Back     alignment and function description
>sp|Q8L467|BH104_ARATH Transcription factor bHLH104 OS=Arabidopsis thaliana GN=BHLH104 PE=2 SV=1 Back     alignment and function description
>sp|Q9C682|BH115_ARATH Transcription factor bHLH115 OS=Arabidopsis thaliana GN=BHLH115 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query241
255540993314 DNA binding protein, putative [Ricinus c 0.921 0.707 0.614 3e-70
357477533224 Transcription factor bHLH47 [Medicago tr 0.917 0.986 0.601 1e-68
449440776260 PREDICTED: transcription factor bHLH47-l 0.892 0.826 0.619 5e-67
358248626222 uncharacterized protein LOC100782436 [Gl 0.917 0.995 0.576 2e-65
356562826225 PREDICTED: transcription factor bHLH47-l 0.925 0.991 0.557 4e-63
224134797241 predicted protein [Populus trichocarpa] 0.896 0.896 0.566 4e-60
225456737 360 PREDICTED: transcription factor bHLH47-l 0.921 0.616 0.551 5e-59
302398595246 BHLH domain class transcription factor [ 0.962 0.943 0.557 6e-59
224071043221 predicted protein [Populus trichocarpa] 0.896 0.977 0.562 9e-59
356519056247 PREDICTED: LOW QUALITY PROTEIN: transcri 0.858 0.838 0.551 1e-58
>gi|255540993|ref|XP_002511561.1| DNA binding protein, putative [Ricinus communis] gi|223550676|gb|EEF52163.1| DNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  270 bits (691), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 145/236 (61%), Positives = 170/236 (72%), Gaps = 14/236 (5%)

Query: 1   MGSESSASLDEEVNVMVVDASVDGHCPTKKNKSRVPKRVHKAEREKLKREHLNDLFLDLA 60
           M S+ S S  ++VNV V        CP  KNK +VPKR+HKAEREKLKRE LNDLFLDLA
Sbjct: 90  MASDISPSASDDVNVTV--EPTKRSCP-GKNKGKVPKRIHKAEREKLKREQLNDLFLDLA 146

Query: 61  NAVEVNQPNNGKACVLNEAARLLKDLFSQIESLNKENASLLSESHYVTIEKNELKEENSS 120
           +A+++ QPNNGKA +L EAARLLKDLF QIE L KEN SLLSES YVT+EKNEL+EEN +
Sbjct: 147 DALDLTQPNNGKASILCEAARLLKDLFGQIECLKKENESLLSESRYVTVEKNELREENLA 206

Query: 121 LESQIEVLQSELRARVVQSKPDLNI-PPEFQQPELSSHFPGDSYGFPAAVEPTLSQAPAV 179
           LE+QIE LQ EL A+ VQSKPDLN+ PPE   PEL+ HF G+S G P A +    QAPAV
Sbjct: 207 LETQIESLQGELEAKAVQSKPDLNMPPPELHHPELAPHFTGESLGLPVA-DGIPQQAPAV 265

Query: 180 LVVPIHSDLQAYSASDVAQLTSKPASNVSKPHARYPNPADSWPSQLLGENISSTRE 235
            VVP+H  LQAY          +  +NVSKPHARY  PADSWPSQLL E ++  +E
Sbjct: 266 FVVPLHPSLQAY---------PRTTTNVSKPHARYATPADSWPSQLLEEQLTIRKE 312

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|357477533|ref|XP_003609052.1| Transcription factor bHLH47 [Medicago truncatula] gi|217072776|gb|ACJ84748.1| unknown [Medicago truncatula] gi|355510107|gb|AES91249.1| Transcription factor bHLH47 [Medicago truncatula] Back     alignment and taxonomy information
>gi|449440776|ref|XP_004138160.1| PREDICTED: transcription factor bHLH47-like isoform 1 [Cucumis sativus] gi|449440778|ref|XP_004138161.1| PREDICTED: transcription factor bHLH47-like isoform 2 [Cucumis sativus] gi|449477266|ref|XP_004154976.1| PREDICTED: transcription factor bHLH47-like isoform 1 [Cucumis sativus] gi|449477270|ref|XP_004154977.1| PREDICTED: transcription factor bHLH47-like isoform 2 [Cucumis sativus] Back     alignment and taxonomy information
>gi|358248626|ref|NP_001240169.1| uncharacterized protein LOC100782436 [Glycine max] gi|255640742|gb|ACU20655.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356562826|ref|XP_003549669.1| PREDICTED: transcription factor bHLH47-like [Glycine max] Back     alignment and taxonomy information
>gi|224134797|ref|XP_002321908.1| predicted protein [Populus trichocarpa] gi|222868904|gb|EEF06035.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225456737|ref|XP_002268400.1| PREDICTED: transcription factor bHLH47-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|302398595|gb|ADL36592.1| BHLH domain class transcription factor [Malus x domestica] Back     alignment and taxonomy information
>gi|224071043|ref|XP_002303343.1| predicted protein [Populus trichocarpa] gi|222840775|gb|EEE78322.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356519056|ref|XP_003528190.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor bHLH47-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query241
TAIR|locus:2079102240 PYE "AT3G47640" [Arabidopsis t 0.921 0.925 0.452 3.2e-42
UNIPROTKB|Q69V10265 P0506F02.119 "cDNA clone:J0230 0.792 0.720 0.388 6.4e-28
UNIPROTKB|Q2R1K8278 Os11g0601700 "Helix-loop-helix 0.917 0.794 0.338 7.8e-23
UNIPROTKB|Q67U21 343 OSJNBa0065F08.2 "Basic helix-l 0.875 0.615 0.274 6e-16
TAIR|locus:2135169286 bHLH11 "AT4G36060" [Arabidopsi 0.543 0.458 0.312 1e-10
TAIR|locus:2092216337 bHLH121 "AT3G19860" [Arabidops 0.609 0.436 0.291 4.2e-10
TAIR|locus:2086198320 bHLH34 "AT3G23210" [Arabidopsi 0.684 0.515 0.258 1.1e-07
UNIPROTKB|Q6ZGM4236 OJ1442_E05.19 "cDNA clone:006- 0.663 0.677 0.281 3.6e-06
TAIR|locus:2157538234 ILR3 "AT5G54680" [Arabidopsis 0.684 0.705 0.284 1.4e-05
TAIR|locus:2129710283 bHLH104 "AT4G14410" [Arabidops 0.585 0.498 0.263 1.9e-05
TAIR|locus:2079102 PYE "AT3G47640" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 447 (162.4 bits), Expect = 3.2e-42, P = 3.2e-42
 Identities = 113/250 (45%), Positives = 148/250 (59%)

Query:     1 MGSESSASLDEEVNVMVVDASVDGHCPTKKNKSRVPKRVHKAEREKLKREHLNDLFLDLA 60
             M S++ ++  +E N     A+ D  C     K +VPKR++KA RE+LKREHLN+LF++LA
Sbjct:     1 MVSKTPSTSSDEAN-----ATADERC----RKGKVPKRINKAVRERLKREHLNELFIELA 51

Query:    61 NAVEVNQPNNGKACVLNEAARLLKDLFSQIESLNKENASLLSESHYVTIXXXXXXXXXXX 120
             + +E+NQ N+GKA +L EA R LKD+F QIESL KE+ASLLSES YVT            
Sbjct:    52 DTLELNQQNSGKASILCEATRFLKDVFGQIESLRKEHASLLSESSYVTTEKNELKEETSV 111

Query:   121 XXXQIEVLQSELRARVVQSKPDLNI-P-PEF-------QQPELSSHFPG----DSYGFPA 167
                +I  LQ+E+ AR  QSKPDLN  P PE+       Q PE  S FPG       GF  
Sbjct:   112 LETEISKLQNEIEARANQSKPDLNTSPAPEYHHHHYQQQHPERVSQFPGLPIFQGPGFQQ 171

Query:   168 AVEPTLSQAPAVLVVPIHSDLQAYSASDVAQLTSKP----ASNVSKPHARYPNPADSWPS 223
             +   TL     VLV+PI  D Q    S++ Q   +P    +SNVSKP  RY + ADSW S
Sbjct:   172 SAT-TLHPPATVLVLPIQPDPQTQDISEMTQ-AQQPLMFNSSNVSKPCPRYASAADSWSS 229

Query:   224 QLLGENISST 233
             +LLGE + ++
Sbjct:   230 RLLGERLKAS 239
GO:0003677 "DNA binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS;IDA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
GO:0010106 "cellular response to iron ion starvation" evidence=IMP
GO:0055072 "iron ion homeostasis" evidence=IMP
UNIPROTKB|Q69V10 P0506F02.119 "cDNA clone:J023068N18, full insert sequence" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q2R1K8 Os11g0601700 "Helix-loop-helix DNA-binding domain containing protein, expressed" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q67U21 OSJNBa0065F08.2 "Basic helix-loop-helix-like protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2135169 bHLH11 "AT4G36060" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2092216 bHLH121 "AT3G19860" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086198 bHLH34 "AT3G23210" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q6ZGM4 OJ1442_E05.19 "cDNA clone:006-303-B03, full insert sequence" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2157538 ILR3 "AT5G54680" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129710 bHLH104 "AT4G14410" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SN74BH047_ARATHNo assigned EC number0.50640.87130.875yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 241
cd0008360 HLH Helix-loop-helix domain, found in specific DNA 99.3
smart0035353 HLH helix loop helix domain. 99.26
PF0001055 HLH: Helix-loop-helix DNA-binding domain only nucl 99.26
KOG1318411 consensus Helix loop helix transcription factor EB 99.03
KOG1319229 consensus bHLHZip transcription factor BIGMAX [Tra 98.42
KOG2483232 consensus Upstream transcription factor 2/L-myc-2 97.97
KOG3561 803 consensus Aryl-hydrocarbon receptor nuclear transl 97.92
KOG4304250 consensus Transcriptional repressors of the hairy/ 97.76
KOG2588 953 consensus Predicted DNA-binding protein [Transcrip 97.33
KOG0561 373 consensus bHLH transcription factor [Transcription 97.28
PRK1542279 septal ring assembly protein ZapB; Provisional 97.04
KOG3960284 consensus Myogenic helix-loop-helix transcription 96.88
COG307479 Uncharacterized protein conserved in bacteria [Fun 96.77
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 96.44
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 96.33
KOG4029228 consensus Transcription factor HAND2/Transcription 96.17
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 95.71
KOG4005292 consensus Transcription factor XBP-1 [Transcriptio 95.67
PLN0321793 transcription factor ATBS1; Provisional 94.71
smart0033865 BRLZ basic region leucin zipper. 94.11
KOG3910632 consensus Helix loop helix transcription factor [T 94.11
PRK11637 428 AmiB activator; Provisional 94.1
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 93.88
PF0017064 bZIP_1: bZIP transcription factor cAMP response el 93.76
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 93.67
KOG2264 907 consensus Exostosin EXT1L [Signal transduction mec 93.44
PF04880166 NUDE_C: NUDE protein, C-terminal conserved region; 93.26
COG3883265 Uncharacterized protein conserved in bacteria [Fun 92.92
PRK10884206 SH3 domain-containing protein; Provisional 92.73
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 92.67
PRK1542279 septal ring assembly protein ZapB; Provisional 92.53
TIGR03752 472 conj_TIGR03752 integrating conjugative element pro 92.37
COG4026290 Uncharacterized protein containing TOPRIM domain, 92.03
KOG3558 768 consensus Hypoxia-inducible factor 1/Neuronal PAS 91.69
PRK13169110 DNA replication intiation control protein YabA; Re 91.65
KOG3559 598 consensus Transcriptional regulator SIM1 [Transcri 91.25
TIGR0244965 conserved hypothetical protein TIGR02449. Members 90.71
COG557057 Uncharacterized small protein [Function unknown] 90.5
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 90.26
PHA02562562 46 endonuclease subunit; Provisional 90.09
COG3883265 Uncharacterized protein conserved in bacteria [Fun 89.9
PRK10884206 SH3 domain-containing protein; Provisional 89.57
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 89.54
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 89.32
PRK11637 428 AmiB activator; Provisional 88.89
PRK13729 475 conjugal transfer pilus assembly protein TraB; Pro 88.84
PF1022480 DUF2205: Predicted coiled-coil protein (DUF2205); 87.95
PF02403108 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom 87.86
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 87.72
PF13851201 GAS: Growth-arrest specific micro-tubule binding 87.1
PRK13169110 DNA replication intiation control protein YabA; Re 87.03
PF13870177 DUF4201: Domain of unknown function (DUF4201) 86.93
PRK0440675 hypothetical protein; Provisional 86.93
COG307479 Uncharacterized protein conserved in bacteria [Fun 86.74
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 86.37
PF14662193 CCDC155: Coiled-coil region of CCDC155 86.31
PF0798975 Microtub_assoc: Microtubule associated; InterPro: 86.3
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 86.19
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 86.18
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 85.99
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 85.92
PRK0211973 hypothetical protein; Provisional 85.91
PF07888546 CALCOCO1: Calcium binding and coiled-coil domain ( 85.9
KOG3560 712 consensus Aryl-hydrocarbon receptor [Transcription 85.79
PF0537755 FlaC_arch: Flagella accessory protein C (FlaC); In 85.57
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 85.45
PF0497780 DivIC: Septum formation initiator; InterPro: IPR00 85.41
PF14662193 CCDC155: Coiled-coil region of CCDC155 85.36
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 85.2
PF0017064 bZIP_1: bZIP transcription factor cAMP response el 85.08
PF05529192 Bap31: B-cell receptor-associated protein 31-like 84.83
PF0432549 DUF465: Protein of unknown function (DUF465); Inte 84.7
PRK0029568 hypothetical protein; Provisional 84.68
PF10146230 zf-C4H2: Zinc finger-containing protein ; InterPro 84.45
COG1340294 Uncharacterized archaeal coiled-coil protein [Func 83.82
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 83.75
COG4467114 Regulator of replication initiation timing [Replic 83.56
PRK0432574 hypothetical protein; Provisional 83.53
PF13851201 GAS: Growth-arrest specific micro-tubule binding 83.42
PRK13922276 rod shape-determining protein MreC; Provisional 83.18
PF10482120 CtIP_N: Tumour-suppressor protein CtIP N-terminal 83.15
COG2433652 Uncharacterized conserved protein [Function unknow 83.12
PRK0279372 phi X174 lysis protein; Provisional 83.1
PF13815118 Dzip-like_N: Iguana/Dzip1-like DAZ-interacting pro 83.08
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 82.76
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 82.67
PF1232974 TMF_DNA_bd: TATA element modulatory factor 1 DNA b 82.59
PTZ00454 398 26S protease regulatory subunit 6B-like protein; P 82.37
TIGR0244965 conserved hypothetical protein TIGR02449. Members 82.36
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 82.19
TIGR02231 525 conserved hypothetical protein. This family consis 82.15
KOG0977 546 consensus Nuclear envelope protein lamin, intermed 82.08
PF0771654 bZIP_2: Basic region leucine zipper; InterPro: IPR 82.04
smart0033865 BRLZ basic region leucin zipper. 81.55
PF07798177 DUF1640: Protein of unknown function (DUF1640); In 81.53
PF10186302 Atg14: UV radiation resistance protein and autopha 81.52
PF05565162 Sipho_Gp157: Siphovirus Gp157; InterPro: IPR008840 81.41
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 81.29
PF0500879 V-SNARE: Vesicle transport v-SNARE protein N-termi 81.23
PRK0084677 hypothetical protein; Provisional 81.2
PF0410269 SlyX: SlyX; InterPro: IPR007236 The SlyX protein h 81.05
PHA03011120 hypothetical protein; Provisional 81.0
PRK09039343 hypothetical protein; Validated 80.81
PF05667 594 DUF812: Protein of unknown function (DUF812); Inte 80.72
PF08172248 CASP_C: CASP C terminal; InterPro: IPR012955 This 80.56
PRK13729 475 conjugal transfer pilus assembly protein TraB; Pro 80.43
PF02403108 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom 80.11
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 80.03
PHA02562562 46 endonuclease subunit; Provisional 80.01
>cd00083 HLH Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long Back     alignment and domain information 
Probab=99.30  E-value=2.9e-12  Score=89.33  Aligned_cols=56  Identities=27%  Similarity=0.373  Sum_probs=49.8

Q ss_pred             CCccchhhHHHhhHHHhhHhHHHhhhccCCC--CCCCchhhhHHHHHHHHHHHHHHHH
Q 026212           36 PKRVHKAEREKLKREHLNDLFLDLANAVEVN--QPNNGKACVLNEAARLLKDLFSQIE   91 (241)
Q Consensus        36 ~rk~~Ka~rER~RRdkLNerF~~L~slL~P~--~~K~DKasIL~DAI~ylk~Lr~~v~   91 (241)
                      .++..|+.+||.||+++|+.|.+|+.+|.+.  ..|.||++||..||+||+.|+.+++
T Consensus         3 ~~r~~~~~~Er~RR~~~n~~~~~L~~llp~~~~~~k~~k~~iL~~a~~yI~~L~~~~~   60 (60)
T cd00083           3 SRREAHNLRERRRRERINDAFDELRSLLPTLPPSKKLSKAEILRKAVDYIKSLQELLQ   60 (60)
T ss_pred             HHHHHHhHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHhC
Confidence            3567899999999999999999999999444  2899999999999999999998763

A DNA-binding basic region is followed by two alpha-helices separated by a variable loop region; HLH forms homo- and heterodimers, dimerization creates a parallel, left-handed, four helix bundle; the basic region N-terminal to the first amphipathic helix mediates high-affinity DNA-binding; there are several groups of HLH proteins: those (E12/E47) which bind specific hexanucleotide sequences such as E-box (5-CANNTG-3) or StRE 5-ATCACCCCAC-3), those lacking the basic domain (Emc, Id) function as negative regulators since they fail to bind DNA, those (hairy, E(spl), deadpan) which repress transcription although they can bind specific hexanucleotide sequences such as N-box (5-CACGc/aG-3), those which have a COE domain (Collier/Olf-1/EBF) which is involved in both in dimerization and in DNA binding, and those which bind pentanucleotides ACGTG or GCGTG and
>smart00353 HLH helix loop helix domain Back     alignment and domain information
>PF00010 HLH: Helix-loop-helix DNA-binding domain only nuclear translocator protein (Arnt) Back     alignment and domain information
>KOG1318 consensus Helix loop helix transcription factor EB [Transcription] Back     alignment and domain information
>KOG1319 consensus bHLHZip transcription factor BIGMAX [Transcription] Back     alignment and domain information
>KOG2483 consensus Upstream transcription factor 2/L-myc-2 protein [Transcription] Back     alignment and domain information
>KOG3561 consensus Aryl-hydrocarbon receptor nuclear translocator [Transcription] Back     alignment and domain information
>KOG4304 consensus Transcriptional repressors of the hairy/E(spl) family (contains HLH) [Transcription] Back     alignment and domain information
>KOG2588 consensus Predicted DNA-binding protein [Transcription] Back     alignment and domain information
>KOG0561 consensus bHLH transcription factor [Transcription] Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>KOG3960 consensus Myogenic helix-loop-helix transcription factor [Transcription] Back     alignment and domain information
>COG3074 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>KOG4029 consensus Transcription factor HAND2/Transcription factor TAL1/TAL2/LYL1 [Transcription] Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>KOG4005 consensus Transcription factor XBP-1 [Transcription] Back     alignment and domain information
>PLN03217 transcription factor ATBS1; Provisional Back     alignment and domain information
>smart00338 BRLZ basic region leucin zipper Back     alignment and domain information
>KOG3910 consensus Helix loop helix transcription factor [Transcription] Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>KOG2264 consensus Exostosin EXT1L [Signal transduction mechanisms] Back     alignment and domain information
>PF04880 NUDE_C: NUDE protein, C-terminal conserved region; InterPro: IPR006964 This domain represents the C-terminal conserved region of NUDE proteins Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>KOG3558 consensus Hypoxia-inducible factor 1/Neuronal PAS domain protein NPAS1 [Signal transduction mechanisms; Transcription] Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>KOG3559 consensus Transcriptional regulator SIM1 [Transcription] Back     alignment and domain information
>TIGR02449 conserved hypothetical protein TIGR02449 Back     alignment and domain information
>COG5570 Uncharacterized small protein [Function unknown] Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PRK13729 conjugal transfer pilus assembly protein TraB; Provisional Back     alignment and domain information
>PF10224 DUF2205: Predicted coiled-coil protein (DUF2205); InterPro: IPR019357 This entry represents a highly conserved 100 residue region which is likely to have a coiled-coil structure Back     alignment and domain information
>PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>PF13870 DUF4201: Domain of unknown function (DUF4201) Back     alignment and domain information
>PRK04406 hypothetical protein; Provisional Back     alignment and domain information
>COG3074 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>PF07989 Microtub_assoc: Microtubule associated; InterPro: IPR012943 Proteins with this domain associate with the spindle body during cell division [] Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>PRK02119 hypothetical protein; Provisional Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>KOG3560 consensus Aryl-hydrocarbon receptor [Transcription] Back     alignment and domain information
>PF05377 FlaC_arch: Flagella accessory protein C (FlaC); InterPro: IPR008039 Although archaeal flagella appear superficially similar to those of bacteria, they are quite distinct [] Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>PF04977 DivIC: Septum formation initiator; InterPro: IPR007060 DivIC, from the spore-forming, Gram-positive bacterium Bacillus subtilis, is necessary for both vegetative and sporulation septum formation [] Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization Back     alignment and domain information
>PF05529 Bap31: B-cell receptor-associated protein 31-like ; InterPro: IPR008417 Bap31 is a polytopic integral protein of the endoplasmic reticulum membrane and a substrate of caspase-8 Back     alignment and domain information
>PF04325 DUF465: Protein of unknown function (DUF465); InterPro: IPR007420 Family members are found in small bacterial proteins, and also in the heavy chains of eukaryotic myosin and kinesin, C-terminal of the motor domain Back     alignment and domain information
>PRK00295 hypothetical protein; Provisional Back     alignment and domain information
>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>COG4467 Regulator of replication initiation timing [Replication, recombination, and repair] Back     alignment and domain information
>PRK04325 hypothetical protein; Provisional Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>PRK13922 rod shape-determining protein MreC; Provisional Back     alignment and domain information
>PF10482 CtIP_N: Tumour-suppressor protein CtIP N-terminal domain; InterPro: IPR019518 CtIP is predominantly a nuclear protein that complexes with both BRCA1 and the BRCA1-associated RING domain protein (BARD1) Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK02793 phi X174 lysis protein; Provisional Back     alignment and domain information
>PF13815 Dzip-like_N: Iguana/Dzip1-like DAZ-interacting protein N-terminal Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>TIGR02449 conserved hypothetical protein TIGR02449 Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>TIGR02231 conserved hypothetical protein Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>PF07716 bZIP_2: Basic region leucine zipper; InterPro: IPR011700 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotes are proteins that contain a basic region mediating sequence-specific DNA-binding, followed by a leucine zipper region (see IPR002158 from INTERPRO), which is required for dimerization Back     alignment and domain information
>smart00338 BRLZ basic region leucin zipper Back     alignment and domain information
>PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>PF05565 Sipho_Gp157: Siphovirus Gp157; InterPro: IPR008840 This family contains both viral and bacterial proteins which are related to the Gp157 protein of the Streptococcus thermophilus SFi bacteriophage Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>PF05008 V-SNARE: Vesicle transport v-SNARE protein N-terminus; InterPro: IPR007705 V-SNARE proteins are required for protein traffic between eukaryotic organelles Back     alignment and domain information
>PRK00846 hypothetical protein; Provisional Back     alignment and domain information
>PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function Back     alignment and domain information
>PHA03011 hypothetical protein; Provisional Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>PF08172 CASP_C: CASP C terminal; InterPro: IPR012955 This domain is the C-terminal region of the CASP family of proteins Back     alignment and domain information
>PRK13729 conjugal transfer pilus assembly protein TraB; Provisional Back     alignment and domain information
>PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query241
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 5e-06
1nkp_A88 C-MYC, MYC proto-oncogene protein; transcription, 2e-05
1am9_A82 Srebp-1A, protein (sterol regulatory element bindi 7e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Length = 83 Back     alignment and structure
 Score = 42.8 bits (101), Expect = 5e-06
 Identities = 20/94 (21%), Positives = 43/94 (45%), Gaps = 16/94 (17%)

Query: 37  KRVHKAEREKLKREHLNDLFLDLANAV-EVNQPNNGKACVLNEAARLLKDLFSQIESLNK 95
           +  H    E+ +R+H+ D F  L ++V  +      +A +L++A          I+ + +
Sbjct: 3   RAHHN-ALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEY-------IQYMRR 54

Query: 96  ENASLLSESHYVTIEKNELKEENSSLESQIEVLQ 129
           +N +   +        ++LK +N+ LE Q+  L 
Sbjct: 55  KNHTHQQD-------IDDLKRQNALLEQQVRALG 81
>1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Length = 88 Back     alignment and structure
>1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Length = 82 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query241
1am9_A82 Srebp-1A, protein (sterol regulatory element bindi 99.67
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 99.6
1nkp_A88 C-MYC, MYC proto-oncogene protein; transcription, 99.6
4ati_A118 MITF, microphthalmia-associated transcription fact 99.58
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, 99.51
1hlo_A80 Protein (transcription factor MAX); transcriptiona 99.5
4h10_B71 Circadian locomoter output cycles protein kaput; B 99.49
1an4_A65 Protein (upstream stimulatory factor); protein-DNA 99.41
4h10_A73 ARYL hydrocarbon receptor nuclear translocator-LI 99.33
1a0a_A63 BHLH, protein (phosphate system positive regulator 99.28
3u5v_A76 Protein MAX, transcription factor E2-alpha chimer; 99.2
4f3l_A 361 Mclock, circadian locomoter output cycles protein 99.0
1mdy_A68 Protein (MYOD BHLH domain); protein-DNA complex, t 98.85
4f3l_B 387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 98.81
2ql2_B60 Neurod1, neurogenic differentiation factor 1; basi 98.79
4ath_A83 MITF, microphthalmia-associated transcription fact 98.68
2lfh_A68 DNA-binding protein inhibitor ID-3; structural gen 98.2
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 97.43
4aya_A97 DNA-binding protein inhibitor ID-2; cell cycle; 2. 96.96
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 95.88
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 94.94
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 94.8
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 93.11
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 92.6
3qh9_A81 Liprin-beta-2; coiled-coil, dimerization, structur 92.16
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 92.13
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 91.99
2yy0_A53 C-MYC-binding protein; conserved hypothetical prot 91.8
3he5_B52 Synzip2; heterodimeric coiled-coil, de novo protei 91.55
2oqq_A42 Transcription factor HY5; homodimer leucine zipper 91.4
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 90.65
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 90.01
3cve_A72 Homer protein homolog 1; coiled coil, alternative 89.77
3s9g_A104 Protein hexim1; cyclin T-binding domain (TBD), cyc 89.32
3m9b_A251 Proteasome-associated ATPase; coil COIL with 5 bet 88.36
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 88.25
3nmd_A72 CGMP dependent protein kinase; leucine zipper, coi 87.96
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 87.55
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 86.42
3q8t_A96 Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 86.36
3i00_A120 HIP-I, huntingtin-interacting protein 1; transcrip 85.76
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 85.75
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 85.69
3cvf_A79 Homer-3, homer protein homolog 3; coiled coil, alt 85.48
3iv1_A78 Tumor susceptibility gene 101 protein; coiled_COIL 85.22
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coi 84.77
3s4r_A93 Vimentin; alpha-helix, cytoskeleton, intermediate 84.31
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 84.1
3m9b_A251 Proteasome-associated ATPase; coil COIL with 5 bet 83.56
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 83.39
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 83.15
3mq7_A121 Bone marrow stromal antigen 2; HIV, antiviral prot 83.01
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 83.0
3m91_A51 Proteasome-associated ATPase; coil COIL alpha heli 82.57
4h22_A103 Leucine-rich repeat flightless-interacting protei; 82.4
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 82.1
3htk_A60 Structural maintenance of chromosomes protein 5; S 81.93
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 81.47
2w83_C77 C-JUN-amino-terminal kinase-interacting protein 4; 81.26
3swf_A74 CGMP-gated cation channel alpha-1; coiled-coil, as 81.26
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 81.02
3swy_A46 Cyclic nucleotide-gated cation channel alpha-3; co 80.68
2oxj_A34 Hybrid alpha/beta peptide based on the GCN4-P1 Se 80.34
2v66_B111 Nuclear distribution protein NUDE-like 1; structur 80.2
3swk_A86 Vimentin; cytoskeleton, intermediate filament, alp 80.2
1deb_A54 APC protein, adenomatous polyposis coli protein; c 80.08
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 80.07
>1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Back     alignment and structure
Probab=99.67  E-value=5.4e-17  Score=122.56  Aligned_cols=72  Identities=29%  Similarity=0.344  Sum_probs=65.4

Q ss_pred             CCccchhhHHHhhHHHhhHhHHHhhhccCCCC-CCCchhhhHHHHHHHHHHHHHHHHHHHHhhhccchhhhHHH
Q 026212           36 PKRVHKAEREKLKREHLNDLFLDLANAVEVNQ-PNNGKACVLNEAARLLKDLFSQIESLNKENASLLSESHYVT  108 (241)
Q Consensus        36 ~rk~~Ka~rER~RRdkLNerF~~L~slL~P~~-~K~DKasIL~DAI~ylk~Lr~~v~~Lk~~n~~L~ees~~L~  108 (241)
                      .|+.+|+..||+||++||++|.+|+++| |+. .|+||++||.+||+||+.|+.+++.|+.++..|..++...+
T Consensus         5 ~rr~~H~~~ErrRR~~in~~f~~L~~lv-P~~~~k~~Ka~IL~~Ai~YI~~Lq~~~~~L~~e~~~L~~~~~~~~   77 (82)
T 1am9_A            5 EKRTAHNAIEKRYRSSINDKIIELKDLV-VGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLRTAVHKSK   77 (82)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHH-TCSSCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHhhhhHHHHHHHHHHHHHHHHHHhc-cCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhh
Confidence            4678899999999999999999999998 765 89999999999999999999999999999988887766554
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Back     alignment and structure
>1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>4ati_A MITF, microphthalmia-associated transcription factor; DNA-binding protein-DNA complex, melanoma; 2.60A {Mus musculus} PDB: 4atk_A Back     alignment and structure
>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>4h10_B Circadian locomoter output cycles protein kaput; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} Back     alignment and structure
>1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>4h10_A ARYL hydrocarbon receptor nuclear translocator-LI 1; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} Back     alignment and structure
>1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 Back     alignment and structure
>3u5v_A Protein MAX, transcription factor E2-alpha chimer; basic helix-loop-helix (BHLH); 1.70A {Mus musculus} PDB: 2ql2_A* Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>1mdy_A Protein (MYOD BHLH domain); protein-DNA complex, transcription/DNA complex; HET: DNA; 2.80A {Mus musculus} SCOP: a.38.1.1 PDB: 1mdy_B* Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>2ql2_B Neurod1, neurogenic differentiation factor 1; basic-helix-loop-helix; HET: DNA; 2.50A {Mus musculus} Back     alignment and structure
>4ath_A MITF, microphthalmia-associated transcription factor; DNA binding protein, melanoma; HET: MSE; 1.95A {Mus musculus} Back     alignment and structure
>2lfh_A DNA-binding protein inhibitor ID-3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>4aya_A DNA-binding protein inhibitor ID-2; cell cycle; 2.10A {Homo sapiens} Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3qh9_A Liprin-beta-2; coiled-coil, dimerization, structural protein; 2.01A {Homo sapiens} Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Back     alignment and structure
>2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} Back     alignment and structure
>3he5_B Synzip2; heterodimeric coiled-coil, de novo protein; 1.75A {Artificial gene} Back     alignment and structure
>2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus} Back     alignment and structure
>3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A Back     alignment and structure
>3m9b_A Proteasome-associated ATPase; coil COIL with 5 beta-strand barrel inter domain, chaperone; 3.94A {Mycobacterium tuberculosis} PDB: 3m9d_A Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>3nmd_A CGMP dependent protein kinase; leucine zipper, coiled-coil, structural genomics, berkeley S genomics center, BSGC, dimerization; HET: MSE; 2.27A {Homo sapiens} Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Back     alignment and structure
>3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} Back     alignment and structure
>3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Back     alignment and structure
>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} Back     alignment and structure
>3iv1_A Tumor susceptibility gene 101 protein; coiled_COIL, tumorigenesis, CELL_cycle regulation, alternative splicing, cell cycle, cell division; HET: MSE; 2.50A {Homo sapiens} Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Back     alignment and structure
>3m9b_A Proteasome-associated ATPase; coil COIL with 5 beta-strand barrel inter domain, chaperone; 3.94A {Mycobacterium tuberculosis} PDB: 3m9d_A Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>3m91_A Proteasome-associated ATPase; coil COIL alpha helix, ATP-binding, chaperone, nucleotide-BI proteasome, S-nitrosylation; 1.80A {Mycobacterium tuberculosis} PDB: 3m9h_A Back     alignment and structure
>4h22_A Leucine-rich repeat flightless-interacting protei; nucleic acid sensor, transcription; 2.89A {Homo sapiens} Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Back     alignment and structure
>3htk_A Structural maintenance of chromosomes protein 5; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>2w83_C C-JUN-amino-terminal kinase-interacting protein 4; golgi apparatus, protein transport, ER-golgi transport, ARF, GTPase, effector, myristate; HET: GTP; 1.93A {Homo sapiens} Back     alignment and structure
>3swf_A CGMP-gated cation channel alpha-1; coiled-coil, assembly domain, transport protein; 2.14A {Bos taurus} Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Back     alignment and structure
>3swy_A Cyclic nucleotide-gated cation channel alpha-3; coiled-coil, assembly domain, transport protein; 1.90A {Homo sapiens} Back     alignment and structure
>2oxj_A Hybrid alpha/beta peptide based on the GCN4-P1 Se heptad positions B and F substituted...; helix bundle, foldamer, unknown function; HET: B3K B3D B3E B3S B3Y B3X B3A BAL; 2.00A {Synthetic} PDB: 2oxk_A* Back     alignment and structure
>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} Back     alignment and structure
>3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} Back     alignment and structure
>1deb_A APC protein, adenomatous polyposis coli protein; coiled coil, tumor suppressor, structural protein; 2.40A {Homo sapiens} SCOP: h.1.18.1 Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 241
d1am9a_80 a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxI 3e-09
d1nkpb_83 a.38.1.1 (B:) Max protein {Human (Homo sapiens) [T 2e-08
d1nkpa_88 a.38.1.1 (A:) Myc proto-oncogene protein {Human (H 1e-07
d1uklc_61 a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId 8e-06
d1nlwa_79 a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [T 2e-05
d1mdya_68 a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus muscul 4e-05
>d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure

class: All alpha proteins
fold: HLH-like
superfamily: HLH, helix-loop-helix DNA-binding domain
family: HLH, helix-loop-helix DNA-binding domain
domain: SREBP-1a
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 50.3 bits (120), Expect = 3e-09
 Identities = 22/74 (29%), Positives = 35/74 (47%)

Query: 32  KSRVPKRVHKAEREKLKREHLNDLFLDLANAVEVNQPNNGKACVLNEAARLLKDLFSQIE 91
           +SR  KR      EK  R  +ND  ++L + V   +    K+ VL +A   ++ L    +
Sbjct: 1   QSRGEKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQ 60

Query: 92  SLNKENASLLSESH 105
            L +EN SL +  H
Sbjct: 61  KLKQENLSLRTAVH 74
>d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 68 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query241
d1am9a_80 SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} 99.63
d1nkpb_83 Max protein {Human (Homo sapiens) [TaxId: 9606]} 99.61
d1nkpa_88 Myc proto-oncogene protein {Human (Homo sapiens) [ 99.57
d1nlwa_79 Mad protein {Human (Homo sapiens) [TaxId: 9606]} 99.55
d1uklc_61 SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} 99.44
d1a0aa_63 Pho4 B/HLH domain {Baker's yeast (Saccharomyces ce 99.38
d1mdya_68 Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10 99.33
d1an4a_65 Usf B/HLH domain {Human (Homo sapiens) [TaxId: 960 99.24
>d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: HLH-like
superfamily: HLH, helix-loop-helix DNA-binding domain
family: HLH, helix-loop-helix DNA-binding domain
domain: SREBP-1a
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.63  E-value=7.6e-17  Score=118.88  Aligned_cols=73  Identities=30%  Similarity=0.353  Sum_probs=63.8

Q ss_pred             CCCCccchhhHHHhhHHHhhHhHHHhhhccCCC-CCCCchhhhHHHHHHHHHHHHHHHHHHHHhhhccchhhhHH
Q 026212           34 RVPKRVHKAEREKLKREHLNDLFLDLANAVEVN-QPNNGKACVLNEAARLLKDLFSQIESLNKENASLLSESHYV  107 (241)
Q Consensus        34 k~~rk~~Ka~rER~RRdkLNerF~~L~slL~P~-~~K~DKasIL~DAI~ylk~Lr~~v~~Lk~~n~~L~ees~~L  107 (241)
                      +..|+..|+..||+||++||+.|.+|+++| |+ ..|+||++||.+||.||++|+.+++.|+.++..|..++..+
T Consensus         3 ~~~kR~~H~~~Er~RR~~in~~~~~L~~ll-P~~~~k~~K~~iL~~a~~yI~~L~~~~~~L~~e~~~lk~~~~~~   76 (80)
T d1am9a_           3 RGEKRTAHNAIEKRYRSSINDKIIELKDLV-VGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLRTAVHKS   76 (80)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-TCSSCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             cchHHHHHHHHHHHHHHHHHHHHHHHHhcC-CCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            345678899999999999999999999998 65 47999999999999999999999999988887776665544
>d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure