Citrus Sinensis ID: 026219

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-
MGASHLCLHYCYYQSAAGFAAFHRTAKALISKPSSTFLCRRRHHHRCLYRNTASAASAACNTSKEIRSTDLVALEFAELNLPVSNKITGELGHARIRQHVNPLSSSFTVPAPIPDWSEVYKNPTLPLMVDIGSGSGRFLIWLARRNPDSGNYLGLEIRQKLVKRAEFWVQELALSNIHFLFANASVSFKQLVSSYPGPLMLVSILCPDPHFKKKHHKRRVVQKPLVDSIIDYLMPGGKVYF
ccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccHHHHHHcccccccccccccccccHHHHcccccccEEEEECccccHHHHHHHHHccccccEEEEEEEHHHHHHHHHHHHHHccccEEEEcccHHHHHHHHHccccccccEEEEEcccccccccccccccccHHHHHHHHHHcccccEEEc
***SHLCLHYCYYQSAAGFAAFHRTAKALISKPSSTFLCRRRHHHRCLYRNT**********S*EIRSTDLVALEFAELNLPVSNKITGELGHARIRQHVNPLSSSFTVPAPIPDWSEVYKNPTLPLMVDIGSGSGRFLIWLARRNPDSGNYLGLEIRQKLVKRAEFWVQELALSNIHFLFANASVSFKQLVSSYPGPLMLVSILCPDPHFKKKHHKRRVVQKPLVDSIIDYLMPGGKVYF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGASHLCLHYCYYQSAAGFAAFHRTAKALISKPSSTFLCRRRHHHRCLYRNTASAASAACNTSKEIRSTDLVALEFAELNLPVSNKITGELGHARIRQHVNPLSSSFTVPAPIPDWSEVYKNPTLPLMVDIGSGSGRFLIWLARRNPDSGNYLGLEIRQKLVKRAEFWVQELALSNIHFLFANASVSFKQLVSSYPGPLMLVSILCPDPHFKKKHHKRRVVQKPLVDSIIDYLMPGGKVYF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
tRNA (guanine-N(7)-)-methyltransferase Catalyzes the formation of N(7)-methylguanine at position 46 (m7G46) in tRNA.probableQ2JJQ0

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2FCA, chain A
Confidence level:very confident
Coverage over the Query: 114-241
View the alignment between query and template
View the model in PyMOL
Template: 2VDV, chain E
Confidence level:very confident
Coverage over the Query: 101-241
View the alignment between query and template
View the model in PyMOL