Citrus Sinensis ID: 026244


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-
MSVIDILTRVDSICKKYDKYDVEKQRETNVSGDDAFARLYGAVEADIEAALQKAESASNEKNRASVVALNAEIRRTKARLLEEVPKLQRLAIKKVKGLSTEELVARNDLVLALPDRIQAIPDGTAAAPKQSGGWGASASRTEIKFDSDGRFDDEYFQQTEESSQFRQEYEMRKMKQDQGLDMISEGLDTLKNMAHDMNEEVDRQVPLMDEIDTKVDRATADLKNTNVRLKHTVTQVMTFNL
ccHHHHHHHHHHHHHHHHHccHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccHHccccccccccccccccccccccccccccccHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc
*SVIDILTRVDSICKKYDKYDVEK****NVSGDDAFARLYGAVEADIE*****************VVALNAEIRRTKARLLEEVPKLQRLAIKKVKGLSTEELVARNDLVLALPDRIQAI**********************************************************GLDMISEGLDTLKNMAHDMNEEVDRQVPLMDEIDTKVDRATADLKNTNVRLKHTVTQVMTF**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSVIDILTRVDSICKKYDKYDVEKQRETNVSGDDAFARLxxxxxxxxxxxxxxxxxxxxxKNRASVVALNAEIRRTKARLLEEVPKLQRLAIKKVKGLSTEELVARNDLVLALPDRIQAIPDGTAAAPKQSGGWGASASRTEIKFDSDGRFDDEYFQQTEESSQFRQEYEMRKMKQDQGLDMISEGLDTLKNMAHDMNEEVDRQVPLMDEIDTKVDRATADLKNTNVRLKHTVTQVMTFNL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Syntaxin-71 Vesicle trafficking protein that functions in the secretory pathway.confidentQ9SF29

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2NPS, chain D
Confidence level:confident
Coverage over the Query: 177-238
View the alignment between query and template
View the model in PyMOL
Template: 4DND, chain A
Confidence level:confident
Coverage over the Query: 34-124
View the alignment between query and template
View the model in PyMOL
Template: 1DN1, chain B
Confidence level:probable
Coverage over the Query: 34-226
View the alignment between query and template
View the model in PyMOL