Citrus Sinensis ID: 026285


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240
MAFASRLASKSKQLCSSQVILQRQHAISVRFFANEAAPQALKGDEMLKNIFLDVKKKFETALGVLRKEKITIAPEDPAAVSQYANVMKTVREKADLFSESQRIAYTIETRTAGIPDARTYLLTLKEIRERRGLIDEHGAEAMMMDALEKVEKEIKKPLMRNDKKGMALLTAEFDKINKKLGIRKEDLPKYEEQLELKIAKAQLEELKKDALEAMETQKKREEFKDEEMVEVKSLDVRNFL
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccc
************QLCSSQVILQRQHAISVRFFANEAAPQALKGDEMLKNIFLDVKKKFETALGVLRKEKI*IAPEDPAAVSQYANVMKTVREKADLFSESQRIAYTIETRTAGIPDARTYLLTLKEIRERRGLIDE***EAMMMDALEKVEKEIKKPLMRNDKKGMALLTAEFDKINKKLGIRKEDLPKYEEQLELKIAKAQLEEL********************EMVEVKSLDVRNFL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAFASRLASKSKQLCSSQVILQRQHAISVRFFANEAAPQALKGDEMLKNIFLDVKKKFETALGVLRKEKITIAPEDPAAVSQYANVMKTVREKADLFSESQRIAYTIETRTAGIPDARTYLLTLKEIRERRGLIDEHGAEAMMMDALEKVEKEIKKPLMRNDKKGMALLTAEFDKINKKLGIRKEDLPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEEFKDEEMVEVKSLDVRNFL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable ATP synthase 24 kDa subunit, mitochondrial Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain.confidentQ9SJ12

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!