Citrus Sinensis ID: 026288


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240
MSSPAEYYHSLPPICKAYGTLCVAVATVCSLGLLDLSILALEYKLVFSKFQVWRLITNFFFLGTFSINFGIRLLMIARYGVNLEKGPFERRTADFLWMMIFGALSLLVLSAIPIFRSYFLGISLVFMLVYVWSREFPNSQINIYGLVTLKAFYLPWAMLALDVIFGSPLVPDLLGIIAGHLYYFLTVLHPLATGKNLLKTPKWVQKLVARWRIGAPAINRAQPERTTGVAFRGRSYRLSD
cccHHHHHHcccHHHHHHHHHHHHHHHHHHHccccccEEEEEHHHHHHHccccEEEEEEEccccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccEEEEEEEEcccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccc
*SSPAEYYHSLPPICKAYGTLCVAVATVCSLGLLDLSILALEYKLVFSKFQVWRLITNFFFLGTFSINFGIRLLMIARYGVNLEKGPFERRTADFLWMMIFGALSLLVLSAIPIFRSYFLGISLVFMLVYVWSREFPNSQINIYGLVTLKAFYLPWAMLALDVIFGSPLVPDLLGIIAGHLYYFLTVLHPLATGKNLLKTPKWVQKLVARW*****************************
xxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSPAEYYHSLPPICKAYGTLCVAVATVCSLGLLDLSILALEYKLVFSKFQVWRLITNFFFLGTFSINFGIRLLMIARYGVNLEKGPFERRTADFLWMMIFGALSLLVLSAIPIFRSYFLGISLVFMLVYVWSREFPNSQINIYGLVTLKAFYLPWAMLALDVIFGSPLVPDLLGIIAGHLYYFLTVLHPLATGKNLLKTPKWVQKLVARWRIGAPAINRAQPERTTGVAFRGRSYRLSD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Derlin-1 May be involved in the degradation process of specific misfolded endoplasmic reticulum (ER) luminal proteins.confidentQ06397
Derlin-1 May be involved in the degradation process of specific misfolded endoplasmic reticulum (ER) luminal proteins.probableQ8VZU9
Derlin-1.2 May be involved in the degradation process of specific misfolded endoplasmic reticulum (ER) luminal proteins.probableQ4G2J5

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XOV, chain A
Confidence level:confident
Coverage over the Query: 10-186
View the alignment between query and template
View the model in PyMOL