Citrus Sinensis ID: 026297


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240
MAFVQNLNKKLKDVEISIPIVYGNVAFWLGKKASEYQSHKWTVYVRGATNEDLGVVIKRAVFQLHSSFNNPTRAVESPPFELSESGWGEFEIAITLYFHADVCDKPLNLYHHLKLYPEDESGSMSTKKPVVVESYDEIVFPEPSDSFLARVQNHPAVTLPRLPVGFTLPPPVPIEDTSKRKRGDTKDHPLAQWFMNFSEADELLQLAAARQQVQAHIAKLKRQISLIDGQQQQLRSTSDP
ccccccccccccccEEEEEEEEccEEEEccccccccccCEEEEEEEccccccccccEEEEEEEEccccccccEEEEccccEEEEccCEEEEEEEEEEEEcccccccEEEEEEEEccccccccccccccccEEEEccEEEcccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc
******LNKKLKDVEISIPIVYGNVAFWLGKKASEYQSHKWTVYVRGATNEDLGVVIKRAVFQLHSSFNNPTRAVESPPFELSESGWGEFEIAITLYFHADVCDKPLNLYHHLKLYPED**********VVVESYDEIVFPEPSDSFLARVQNHPAVTL******************************LAQWFMNFSEADELLQLAAARQQVQAHIAKLKRQISL**************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAFVQNLNKKLKDVEISIPIVYGNVAFWLGKKASEYQSHKWTVYVRGATNEDLGVVIKRAVFQLHSSFNNPTRAVESPPFELSESGWGEFEIAITLYFHADVCDKPLNLYHHLKLYPEDESGSMSTKKPVVVESYDEIVFPEPSDSFLARVQNHPAVTLPRLPVGFTLPPPVPIEDTSKRKRGDTKDHPLAQWFMNFSEADExxxxxxxxxxxxxxxxxxxxxISLIDGQQQQLRSTSDP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein AF-9 homolog Component of the SWR1 complex which mediates the ATP-dependent exchange of histone H2A for the H2A variant HZT1 leading to transcriptional regulation of selected genes by chromatin remodeling. Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of selected genes principally by acetylation of nucleosomal histones H4 and H2A. The NuA4 complex is also involved in DNA repair. Yaf9 may also be required for viability in conditions in which the structural integrity of the spindle is compromised.probableQ10319

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3RLS, chain A
Confidence level:very confident
Coverage over the Query: 11-117,128-160
View the alignment between query and template
View the model in PyMOL
Template: 2L5G, chain B
Confidence level:probable
Coverage over the Query: 200-213
View the alignment between query and template
View the model in PyMOL