Citrus Sinensis ID: 026319


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240
MISDEIGLTIMSDCDFDDYVSGTSHNMTNSCIEAITEANKIVGDYINNYDVILDVCYPTIVEQELRLRKMATKMSVGVDVCMTLERFFYLNLPEVQKALHANRTNLPYGWSMCSGVLNYSDTDSNINILPVLKRIIQNGIPVWVFSGDQDSVVPLLGSRTLIRELARDLNFEVTVPYGAWFHKQQVGGWGTEYGNLLTFVTVRGAAHMVPYAQPSRALHLFSSFVHGRRLPNNTRPAIQD
cccHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHcccccccccccccHHHHHHccHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHccccEEEEccccccccccccHHHHHHHHHHHccccEEEcccccccccEEEEEEEEEcccEEEEEEccccccccccccHHHHHHHHHHHccccccccccccccc
cccHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHccccccEEEEccccccccccHHccccccccccccccccccHHHHHHHHccHHHHHHHcccccccccccccccccccccccccccEcHHHHHHHHHcccEEEEEEEcccccccHHHHHHHHHccHHHcccccEcccEEEEEcccEEEEEEEEcccEEEEEEccccccHHHHcHHHHHHHHHHHHHcccccccccccccc
misdeigltimsdcdfddyvsgtshnmTNSCIEAITEANKIVGDYINNYDVILDVCYPTIVEQELRLRKMATKMSVGVDVCMTLERFFYLNLPEVQKALHAnrtnlpygwsmcsgvlnysdtdsniniLPVLKRIIQngipvwvfsgdqdsvvpllgsRTLIRELARDLNfevtvpygawfhkqqvggwgteygNLLTFVTVRGaahmvpyaqpsralhlfssfvhgrrlpnntrpaiqd
MISDEIGLTIMSDCDFDDYVSGTSHNMTNSCIEAITEANKIVGDYINNYDVILDVCYPTIVEQELRLRKMATKMSVGVDVCMTLERFFYLNLPEVQKALHANRTNLPYGWSMCSGVLNYSDTDSNINILPVLKRIIQNGIPVWVFSGDQDSVVPLLGSRTLIRELARDLNFEVTVPYGAWFHKQQVGGWGTEYGNLLTFVTVRGAAHMVPYAQPSRALHLFSSfvhgrrlpnntrpaiqd
MISDEIGLTIMSDCDFDDYVSGTSHNMTNSCIEAITEANKIVGDYINNYDVILDVCYPTIVEQELRLRKMATKMSVGVDVCMTLERFFYLNLPEVQKALHANRTNLPYGWSMCSGVLNYSDTDSNINILPVLKRIIQNGIPVWVFSGDQDSVVPLLGSRTLIRELARDLNFEVTVPYGAWFHKQQVGGWGTEYGNLLTFVTVRGAAHMVPYAQPSRALHLFSSFVHGRRLPNNTRPAIQD
*****IGLTIMSDCDFDDYVSGTSHNMTNSCIEAITEANKIVGDYINNYDVILDVCYPTIVEQELRLRKMATKMSVGVDVCMTLERFFYLNLPEVQKALHANRTNLPYGWSMCSGVLNYSDTDSNINILPVLKRIIQNGIPVWVFSGDQDSVVPLLGSRTLIRELARDLNFEVTVPYGAWFHKQQVGGWGTEYGNLLTFVTVRGAAHMVPYAQPSRALHLFSSFVHG*************
MISDEIGLTIMSDCDFDDYVSGTSHNMTNSCIEAITEANKIVGDYINNYDVILDVCYPT****************VGVDVCMTLERFFYLNLPEVQKALHANRTNLPYGWSMCSGVLNYSDTDSNINILPVLKRIIQNGIPVWVFSGDQDSVVPLLGSRTLIRELARDLNFEVTVPYGAWFHKQQVGGWGTEYGNLLTFVTVRGAAHMVPYAQPSRALHLFSSFVHG*************
MISDEIGLTIMSDCDFDDYVSGTSHNMTNSCIEAITEANKIVGDYINNYDVILDVCYPTIVEQELRLRKMATKMSVGVDVCMTLERFFYLNLPEVQKALHANRTNLPYGWSMCSGVLNYSDTDSNINILPVLKRIIQNGIPVWVFSGDQDSVVPLLGSRTLIRELARDLNFEVTVPYGAWFHKQQVGGWGTEYGNLLTFVTVRGAAHMVPYAQPSRALHLFSSFVHGRRLPNNTRPAIQD
MISDEIGLTIMSDCDFDDYVSGTSHNMTNSCIEAITEANKIVGDYINNYDVILDVCYPTIVEQ*LRLRKMATKMSVGVDVCMTLERFFYLNLPEVQKALHANRTNLPYGWSMCSGVLNYSDTDSNINILPVLKRIIQNGIPVWVFSGDQDSVVPLLGSRTLIRELARDLNFEVTVPYGAWFHKQQVGGWGTEYGNLLTFVTVRGAAHMVPYAQPSRALHLFSSFVHGRR***********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MISDEIGLTIMSDCDFDDYVSGTSHNMTNSCIEAITEANKIVGDYINNYDVILDVCYPTIVEQELRLRKMATKMSVGVDVCMTLERFFYLNLPEVQKALHANRTNLPYGWSMCSGVLNYSDTDSNINILPVLKRIIQNGIPVWVFSGDQDSVVPLLGSRTLIRELARDLNFEVTVPYGAWFHKQQVGGWGTEYGNLLTFVTVRGAAHMVPYAQPSRALHLFSSFVHGRRLPNNTRPAIQD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query240 2.2.26 [Sep-21-2011]
Q9FH05473 Serine carboxypeptidase-l yes no 1.0 0.507 0.75 1e-110
Q9MAR8479 Serine carboxypeptidase-l no no 1.0 0.501 0.687 1e-101
Q9FH06469 Serine carboxypeptidase-l no no 1.0 0.511 0.662 3e-94
Q84W27442 Serine carboxypeptidase-l no no 0.837 0.454 0.618 9e-80
Q8VY01465 Serine carboxypeptidase-l no no 0.966 0.498 0.427 9e-51
Q93Y09461 Serine carboxypeptidase-l no no 0.941 0.490 0.423 5e-48
O82229454 Putative serine carboxype no no 0.904 0.477 0.368 6e-37
Q8L9Y0473 Serine carboxypeptidase-l no no 0.916 0.465 0.378 4e-35
Q1PF08464 Serine carboxypeptidase-l no no 0.908 0.469 0.372 1e-33
Q9M099465 Serine carboxypeptidase 2 no no 0.920 0.475 0.356 3e-33
>sp|Q9FH05|SCP42_ARATH Serine carboxypeptidase-like 42 OS=Arabidopsis thaliana GN=SCPL42 PE=2 SV=1 Back     alignment and function desciption
 Score =  396 bits (1017), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 180/240 (75%), Positives = 205/240 (85%)

Query: 1   MISDEIGLTIMSDCDFDDYVSGTSHNMTNSCIEAITEANKIVGDYINNYDVILDVCYPTI 60
           MISDE+ LTI S CDFDDY   + HN++ +C EAI+E   I+ +Y+NNYDV+LDVCYP+I
Sbjct: 234 MISDELKLTITSQCDFDDYTFASPHNVSTACNEAISETENIITEYVNNYDVLLDVCYPSI 293

Query: 61  VEQELRLRKMATKMSVGVDVCMTLERFFYLNLPEVQKALHANRTNLPYGWSMCSGVLNYS 120
           V+QELRL+KMATKMS+GVDVCMT ER FY NLPEVQKALHANRT+LPY WSMCSGVLNYS
Sbjct: 294 VQQELRLKKMATKMSMGVDVCMTYERRFYFNLPEVQKALHANRTHLPYSWSMCSGVLNYS 353

Query: 121 DTDSNINILPVLKRIIQNGIPVWVFSGDQDSVVPLLGSRTLIRELARDLNFEVTVPYGAW 180
           D D NI++LP+LKRII N  P+W+FSGDQDSVVP  GSRTL+RELA+DLNF+ TVPYGAW
Sbjct: 354 DIDGNIDMLPILKRIILNKTPIWIFSGDQDSVVPFGGSRTLVRELAQDLNFKTTVPYGAW 413

Query: 181 FHKQQVGGWGTEYGNLLTFVTVRGAAHMVPYAQPSRALHLFSSFVHGRRLPNNTRPAIQD 240
           FHK QVGGW  EYG LLTF TVRGAAHMVPYAQPSRALHLFSSFV GRRLPNNT  +  +
Sbjct: 414 FHKSQVGGWAIEYGKLLTFATVRGAAHMVPYAQPSRALHLFSSFVSGRRLPNNTHSSTDE 473




Probable carboxypeptidase.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 4EC: .EC: 1EC: 6EC: .EC: -
>sp|Q9MAR8|SCP44_ARATH Serine carboxypeptidase-like 44 OS=Arabidopsis thaliana GN=SCPL44 PE=2 SV=1 Back     alignment and function description
>sp|Q9FH06|SCP41_ARATH Serine carboxypeptidase-like 41 OS=Arabidopsis thaliana GN=SCPL41 PE=2 SV=1 Back     alignment and function description
>sp|Q84W27|SCP43_ARATH Serine carboxypeptidase-like 43 OS=Arabidopsis thaliana GN=SCPL43 PE=2 SV=1 Back     alignment and function description
>sp|Q8VY01|SCP46_ARATH Serine carboxypeptidase-like 46 OS=Arabidopsis thaliana GN=SCPL46 PE=2 SV=1 Back     alignment and function description
>sp|Q93Y09|SCP45_ARATH Serine carboxypeptidase-like 45 OS=Arabidopsis thaliana GN=SCPL45 PE=2 SV=1 Back     alignment and function description
>sp|O82229|SCP23_ARATH Putative serine carboxypeptidase-like 23 OS=Arabidopsis thaliana GN=SCPL23 PE=2 SV=2 Back     alignment and function description
>sp|Q8L9Y0|SCP25_ARATH Serine carboxypeptidase-like 25 OS=Arabidopsis thaliana GN=SCPL25 PE=2 SV=2 Back     alignment and function description
>sp|Q1PF08|SCP22_ARATH Serine carboxypeptidase-like 22 OS=Arabidopsis thaliana GN=SCPL22 PE=2 SV=1 Back     alignment and function description
>sp|Q9M099|SCP24_ARATH Serine carboxypeptidase 24 OS=Arabidopsis thaliana GN=SCPL24 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query240
356518599 456 PREDICTED: serine carboxypeptidase-like 1.0 0.526 0.837 1e-119
357491047 470 Serine carboxypeptidase-like protein [Me 0.995 0.508 0.824 1e-116
356507606 455 PREDICTED: serine carboxypeptidase-like 1.0 0.527 0.833 1e-116
225457767 467 PREDICTED: serine carboxypeptidase-like 1.0 0.513 0.808 1e-115
356552779 474 PREDICTED: serine carboxypeptidase-like 1.0 0.506 0.820 1e-114
255570400 476 serine carboxypeptidase, putative [Ricin 1.0 0.504 0.787 1e-111
224062940 480 predicted protein [Populus trichocarpa] 1.0 0.5 0.795 1e-111
449520523 377 PREDICTED: serine carboxypeptidase-like 1.0 0.636 0.783 1e-111
449443954 1441 PREDICTED: LOW QUALITY PROTEIN: pentatri 0.991 0.165 0.773 1e-110
297795323 473 hypothetical protein ARALYDRAFT_494806 [ 1.0 0.507 0.758 1e-109
>gi|356518599|ref|XP_003527966.1| PREDICTED: serine carboxypeptidase-like 42-like [Glycine max] Back     alignment and taxonomy information
 Score =  432 bits (1111), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 201/240 (83%), Positives = 218/240 (90%)

Query: 1   MISDEIGLTIMSDCDFDDYVSGTSHNMTNSCIEAITEANKIVGDYINNYDVILDVCYPTI 60
           MISDEIGL I +DCDFDDYV  ++HNM+ SC EAI EAN+IVGDYINNYDVI DVCYP+I
Sbjct: 217 MISDEIGLAITNDCDFDDYVFASAHNMSKSCNEAINEANEIVGDYINNYDVIFDVCYPSI 276

Query: 61  VEQELRLRKMATKMSVGVDVCMTLERFFYLNLPEVQKALHANRTNLPYGWSMCSGVLNYS 120
           VEQELRL+K+ATK+S+GVDVCMT ER FY NLPEVQKALHANRTNLPY WSMCSGVLNYS
Sbjct: 277 VEQELRLKKIATKISIGVDVCMTYERSFYFNLPEVQKALHANRTNLPYQWSMCSGVLNYS 336

Query: 121 DTDSNINILPVLKRIIQNGIPVWVFSGDQDSVVPLLGSRTLIRELARDLNFEVTVPYGAW 180
           DTD NI+ILP+LK+I+QN IPVWVFSGDQDSVVPLLGSRTLIRELA DL F++TVPYGAW
Sbjct: 337 DTDPNIDILPILKKIVQNHIPVWVFSGDQDSVVPLLGSRTLIRELAHDLKFKITVPYGAW 396

Query: 181 FHKQQVGGWGTEYGNLLTFVTVRGAAHMVPYAQPSRALHLFSSFVHGRRLPNNTRPAIQD 240
           FHK QVGGW TEYGNLLTF TVRGAAHMVPYAQPSRALHLFSSFVHGRRLPN T P+I D
Sbjct: 397 FHKGQVGGWVTEYGNLLTFATVRGAAHMVPYAQPSRALHLFSSFVHGRRLPNTTSPSIDD 456




Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|357491047|ref|XP_003615811.1| Serine carboxypeptidase-like protein [Medicago truncatula] gi|355517146|gb|AES98769.1| Serine carboxypeptidase-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356507606|ref|XP_003522555.1| PREDICTED: serine carboxypeptidase-like 42-like [Glycine max] Back     alignment and taxonomy information
>gi|225457767|ref|XP_002278193.1| PREDICTED: serine carboxypeptidase-like 42 [Vitis vinifera] gi|302142765|emb|CBI19968.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356552779|ref|XP_003544740.1| PREDICTED: serine carboxypeptidase-like 42-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|255570400|ref|XP_002526159.1| serine carboxypeptidase, putative [Ricinus communis] gi|223534536|gb|EEF36235.1| serine carboxypeptidase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224062940|ref|XP_002300939.1| predicted protein [Populus trichocarpa] gi|222842665|gb|EEE80212.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449520523|ref|XP_004167283.1| PREDICTED: serine carboxypeptidase-like 42-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449443954|ref|XP_004139740.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At3g09040, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297795323|ref|XP_002865546.1| hypothetical protein ARALYDRAFT_494806 [Arabidopsis lyrata subsp. lyrata] gi|297311381|gb|EFH41805.1| hypothetical protein ARALYDRAFT_494806 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query240
TAIR|locus:2157622473 scpl42 "serine carboxypeptidas 1.0 0.507 0.75 5.6e-100
TAIR|locus:2029127479 scpl44 "serine carboxypeptidas 1.0 0.501 0.687 1.1e-92
TAIR|locus:2157612469 scpl41 "serine carboxypeptidas 1.0 0.511 0.662 1.6e-86
TAIR|locus:2060774443 SCPL43 "serine carboxypeptidas 0.920 0.498 0.556 1.4e-57
TAIR|locus:2051149465 scpl46 "serine carboxypeptidas 0.958 0.494 0.426 9.8e-48
TAIR|locus:2010454461 SCPL45 "serine carboxypeptidas 0.941 0.490 0.423 4.8e-46
TAIR|locus:2078598473 scpl25 "serine carboxypeptidas 0.629 0.319 0.503 2e-33
TAIR|locus:2126644479 scpl29 "serine carboxypeptidas 0.95 0.475 0.348 1.4e-32
TAIR|locus:2181504480 scpl35 "serine carboxypeptidas 0.920 0.460 0.342 1.4e-32
TAIR|locus:2118706465 BRS1 "BRI1 SUPPRESSOR 1" [Arab 0.920 0.475 0.356 3.7e-32
TAIR|locus:2157622 scpl42 "serine carboxypeptidase-like 42" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 992 (354.3 bits), Expect = 5.6e-100, P = 5.6e-100
 Identities = 180/240 (75%), Positives = 205/240 (85%)

Query:     1 MISDEIGLTIMSDCDFDDYVSGTSHNMTNSCIEAITEANKIVGDYINNYDVILDVCYPTI 60
             MISDE+ LTI S CDFDDY   + HN++ +C EAI+E   I+ +Y+NNYDV+LDVCYP+I
Sbjct:   234 MISDELKLTITSQCDFDDYTFASPHNVSTACNEAISETENIITEYVNNYDVLLDVCYPSI 293

Query:    61 VEQELRLRKMATKMSVGVDVCMTLERFFYLNLPEVQKALHANRTNLPYGWSMCSGVLNYS 120
             V+QELRL+KMATKMS+GVDVCMT ER FY NLPEVQKALHANRT+LPY WSMCSGVLNYS
Sbjct:   294 VQQELRLKKMATKMSMGVDVCMTYERRFYFNLPEVQKALHANRTHLPYSWSMCSGVLNYS 353

Query:   121 DTDSNINILPVLKRIIQNGIPVWVFSGDQDSVVPLLGSRTLIRELARDLNFEVTVPYGAW 180
             D D NI++LP+LKRII N  P+W+FSGDQDSVVP  GSRTL+RELA+DLNF+ TVPYGAW
Sbjct:   354 DIDGNIDMLPILKRIILNKTPIWIFSGDQDSVVPFGGSRTLVRELAQDLNFKTTVPYGAW 413

Query:   181 FHKQQVGGWGTEYGNLLTFVTVRGAAHMVPYAQPSRALHLFSSFVHGRRLPNNTRPAIQD 240
             FHK QVGGW  EYG LLTF TVRGAAHMVPYAQPSRALHLFSSFV GRRLPNNT  +  +
Sbjct:   414 FHKSQVGGWAIEYGKLLTFATVRGAAHMVPYAQPSRALHLFSSFVSGRRLPNNTHSSTDE 473




GO:0004185 "serine-type carboxypeptidase activity" evidence=IEA;ISS
GO:0005576 "extracellular region" evidence=ISM
GO:0006508 "proteolysis" evidence=IEA;ISS
GO:0005618 "cell wall" evidence=IDA
TAIR|locus:2029127 scpl44 "serine carboxypeptidase-like 44" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2157612 scpl41 "serine carboxypeptidase-like 41" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2060774 SCPL43 "serine carboxypeptidase-like 43" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2051149 scpl46 "serine carboxypeptidase-like 46" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2010454 SCPL45 "serine carboxypeptidase-like 45" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078598 scpl25 "serine carboxypeptidase-like 25" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2126644 scpl29 "serine carboxypeptidase-like 29" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2181504 scpl35 "serine carboxypeptidase-like 35" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118706 BRS1 "BRI1 SUPPRESSOR 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9FH05SCP42_ARATH3, ., 4, ., 1, 6, ., -0.751.00.5073yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.16LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00014292001
SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (467 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query240
pfam00450415 pfam00450, Peptidase_S10, Serine carboxypeptidase 2e-60
PLN02213319 PLN02213, PLN02213, sinapoylglucose-malate O-sinap 4e-09
PTZ00472462 PTZ00472, PTZ00472, serine carboxypeptidase (CBP1) 6e-09
PLN02209437 PLN02209, PLN02209, serine carboxypeptidase 6e-09
PLN03016433 PLN03016, PLN03016, sinapoylglucose-malate O-sinap 2e-08
COG2939498 COG2939, COG2939, Carboxypeptidase C (cathepsin A) 3e-08
>gnl|CDD|215926 pfam00450, Peptidase_S10, Serine carboxypeptidase Back     alignment and domain information
 Score =  195 bits (497), Expect = 2e-60
 Identities = 74/232 (31%), Positives = 110/232 (47%), Gaps = 18/232 (7%)

Query: 1   MISDEIGLTIMSDCDFDDYVSGTSHNMTNSCIEAITEANKIVGDY--INNYDVILDVCYP 58
           +ISDE+  ++   C                C+  + EA+        IN Y++    CY 
Sbjct: 197 LISDELYESLKKACCGKYP---DCDPANTKCLNLVEEASGCNAYNGGINPYNIYTPCCYN 253

Query: 59  TIVEQELRLRKMATKMSVGVDVCMTLERFFYLNLPEVQKALHANRTNLPYGWSMCSG-VL 117
           +     L L   +T    G D         YLN P+V+KALHAN       WS C+  V 
Sbjct: 254 SS----LSLNPSSTDSCGGYDCYDESYVEKYLNRPDVRKALHAN-KGSVGEWSRCNDEVF 308

Query: 118 NYSDTDSNINILPVLKRIIQNGIPVWVFSGDQDSVVPLLGSRTLIRELARDLNFEVTVPY 177
           N+   D + ++LP+L ++++ G+ V ++SGD D +   LG++  I  L    N+     +
Sbjct: 309 NWYGDDISKSMLPILPKLLEGGLRVLIYSGDHDLICNFLGTQAWIDAL----NWSGKDGF 364

Query: 178 GAWFHK--QQVGGWGTEYGNLLTFVTVRGAAHMVPYAQPSRALHLFSSFVHG 227
             W+     QV G+   YGNL TF TV+GA HMVP  QP  AL +F  F+ G
Sbjct: 365 RPWYVSVDGQVAGYVKSYGNL-TFATVKGAGHMVPEDQPEAALQMFKRFLSG 415


Length = 415

>gnl|CDD|165857 PLN02213, PLN02213, sinapoylglucose-malate O-sinapoyltransferase/ carboxypeptidase Back     alignment and domain information
>gnl|CDD|240429 PTZ00472, PTZ00472, serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information
>gnl|CDD|177859 PLN02209, PLN02209, serine carboxypeptidase Back     alignment and domain information
>gnl|CDD|178590 PLN03016, PLN03016, sinapoylglucose-malate O-sinapoyltransferase Back     alignment and domain information
>gnl|CDD|225490 COG2939, COG2939, Carboxypeptidase C (cathepsin A) [Amino acid transport and metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 240
KOG1282454 consensus Serine carboxypeptidases (lysosomal cath 100.0
PLN02213319 sinapoylglucose-malate O-sinapoyltransferase/ carb 100.0
PLN03016433 sinapoylglucose-malate O-sinapoyltransferase 100.0
PTZ00472462 serine carboxypeptidase (CBP1); Provisional 100.0
PLN02209437 serine carboxypeptidase 100.0
PF00450415 Peptidase_S10: Serine carboxypeptidase; InterPro: 100.0
KOG1283414 consensus Serine carboxypeptidases [Posttranslatio 99.9
COG2939498 Carboxypeptidase C (cathepsin A) [Amino acid trans 99.68
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 97.34
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 97.13
PRK03204286 haloalkane dehalogenase; Provisional 97.11
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 97.03
TIGR03611257 RutD pyrimidine utilization protein D. This protei 97.01
PLN02679360 hydrolase, alpha/beta fold family protein 96.91
PRK10349256 carboxylesterase BioH; Provisional 96.9
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 96.89
PRK10673255 acyl-CoA esterase; Provisional 96.85
PRK00870302 haloalkane dehalogenase; Provisional 96.76
PRK07581339 hypothetical protein; Validated 96.73
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 96.69
PLN03084383 alpha/beta hydrolase fold protein; Provisional 96.63
PRK03592295 haloalkane dehalogenase; Provisional 96.54
PLN02824294 hydrolase, alpha/beta fold family protein 96.47
PHA02857276 monoglyceride lipase; Provisional 96.47
KOG4178322 consensus Soluble epoxide hydrolase [Lipid transpo 96.45
TIGR01392351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 96.35
TIGR02240276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 96.23
PRK08775343 homoserine O-acetyltransferase; Provisional 96.23
PLN02578354 hydrolase 96.17
PLN02965255 Probable pheophorbidase 96.14
KOG1454326 consensus Predicted hydrolase/acyltransferase (alp 96.12
PLN03087481 BODYGUARD 1 domain containing hydrolase; Provision 95.9
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 95.86
PRK00175379 metX homoserine O-acetyltransferase; Provisional 95.81
PF08386103 Abhydrolase_4: TAP-like protein; InterPro: IPR0135 95.79
PRK06765389 homoserine O-acetyltransferase; Provisional 95.69
PLN02298330 hydrolase, alpha/beta fold family protein 95.66
PRK10749330 lysophospholipase L2; Provisional 95.63
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 95.45
PLN02385349 hydrolase; alpha/beta fold family protein 95.41
PLN02894402 hydrolase, alpha/beta fold family protein 95.36
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 95.33
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 95.1
PRK06489360 hypothetical protein; Provisional 95.08
PLN02652395 hydrolase; alpha/beta fold family protein 94.13
TIGR01607332 PST-A Plasmodium subtelomeric family (PST-A). Thes 94.1
PF00326213 Peptidase_S9: Prolyl oligopeptidase family This fa 93.91
PLN02511388 hydrolase 93.57
PF00561230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 93.28
PRK10566249 esterase; Provisional 92.72
PRK11460232 putative hydrolase; Provisional 92.58
PF03583290 LIP: Secretory lipase ; InterPro: IPR005152 This e 92.08
PLN029801655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 92.04
PF07519474 Tannase: Tannase and feruloyl esterase; InterPro: 91.94
PRK05855 582 short chain dehydrogenase; Validated 91.36
KOG4409365 consensus Predicted hydrolase/acyltransferase (alp 90.57
PF02230216 Abhydrolase_2: Phospholipase/Carboxylesterase; Int 89.99
TIGR01249306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 89.9
TIGR03100274 hydr1_PEP hydrolase, ortholog 1, exosortase system 88.67
COG0596282 MhpC Predicted hydrolases or acyltransferases (alp 87.72
PLN02872395 triacylglycerol lipase 87.46
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 87.35
COG0400207 Predicted esterase [General function prediction on 86.96
PLN02211273 methyl indole-3-acetate methyltransferase 86.69
KOG2382315 consensus Predicted alpha/beta hydrolase [General 85.58
TIGR01836350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 83.97
COG1506620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 83.24
PRK10985324 putative hydrolase; Provisional 82.66
COG2267298 PldB Lysophospholipase [Lipid metabolism] 81.96
PRK13604307 luxD acyl transferase; Provisional 81.42
>KOG1282 consensus Serine carboxypeptidases (lysosomal cathepsin A) [Posttranslational modification, protein turnover, chaperones; Amino acid transport and metabolism] Back     alignment and domain information
Probab=100.00  E-value=1.9e-48  Score=356.90  Aligned_cols=221  Identities=40%  Similarity=0.727  Sum_probs=184.8

Q ss_pred             CCCHHHHHHHhccCCCCccCCCCCCCCcchHHHHHHHHHHHhcccCccCcccCCCCCCchhHHHHHHHHhhhccccCcCC
Q 026319            1 MISDEIGLTIMSDCDFDDYVSGTSHNMTNSCIEAITEANKIVGDYINNYDVILDVCYPTIVEQELRLRKMATKMSVGVDV   80 (240)
Q Consensus         1 lis~~~y~~~~~~C~~~~~~~~~~~~~s~~C~~~~~~~~~~~~~~in~Ydi~~~~C~~~~~~~~~~~~~~~~~~~~~~~~   80 (240)
                      ||||++|+.+++.|++...........+..|..+++++......+||+|+|+.+.|.+...  ..    ........+++
T Consensus       231 liSde~~~~l~~~C~~~~~~~~~~~~~~~~C~~~~~~~~~~~~~~i~~y~i~~~~C~~~~~--~~----~~~~~~~~~~~  304 (454)
T KOG1282|consen  231 LISDELYESLKRACDFSSDNYANVDPSNTKCNKAVEEFDSKTTGDIDNYYILTPDCYPTSY--EL----KKPTDCYGYDP  304 (454)
T ss_pred             cCCHHHHHHHHHHhccCcccccccCCchhHHHHHHHHHHHHHhccCchhhhcchhhccccc--cc----cccccccccCC
Confidence            7999999999999998532001122346799999999995443389999999999987221  00    00112346789


Q ss_pred             CcchhhhhccCcHHHHHhhCCCCCCCCCccccccccccccCCCcccccHHHHHHHHhCC-ccEEEEecCCcccCCchhHH
Q 026319           81 CMTLERFFYLNLPEVQKALHANRTNLPYGWSMCSGVLNYSDTDSNINILPVLKRIIQNG-IPVWVFSGDQDSVVPLLGSR  159 (240)
Q Consensus        81 C~~~~~~~ylN~~~V~~aLhv~~~~~~~~w~~cs~~v~~~~~d~~~~~~~~~~~Ll~~~-irVLiY~Gd~D~~~~~~g~~  159 (240)
                      |.+...+.|||+++||+||||+....+ +|+.||+.|...+.|...++++++..++.++ +|||||+||.|++||++||+
T Consensus       305 c~~~~~~~ylN~~~VrkALh~~~~~~~-~W~~Cn~~v~~~~~~~~~sm~p~~~~~~~~~~~rvliysGD~D~~~p~~gt~  383 (454)
T KOG1282|consen  305 CLSDYAEKYLNRPEVRKALHANKTSIG-KWERCNDEVNYNYNDDIKSMLPIHKKLIASGGYRVLIYSGDHDLVVPFLGTQ  383 (454)
T ss_pred             chhhhHHHhcCCHHHHHHhCCCCCCCC-cccccChhhhcccccCccchHHHHHHHhhcCceEEEEEeCCcceeCcchhhH
Confidence            998777999999999999999875433 7999999998767677789999999999865 99999999999999999999


Q ss_pred             HHHHHHHhccCCcccccccceeeC-CEEeEEEEEeCCeEEEEEEcCCCccCCCCChHHHHHHHHHHHCCCCCCCC
Q 026319          160 TLIRELARDLNFEVTVPYGAWFHK-QQVGGWGTEYGNLLTFVTVRGAAHMVPYAQPSRALHLFSSFVHGRRLPNN  233 (240)
Q Consensus       160 ~~i~~l~w~~~~~~~~~~~~w~~~-~~v~G~~~~~~~~Ltf~~V~~AGHmvP~dqP~~a~~~~~~fi~g~~~~~~  233 (240)
                      .|+++|    +++..++|+||+.+ +|||||+++|++ |+|+||+|||||||+|||++|+.||++||.|++++..
T Consensus       384 ~~i~~L----~~~~~~~~~pW~~~~~qvaG~~~~Y~~-ltf~tVrGaGH~VP~~~p~~al~m~~~fl~g~~l~~~  453 (454)
T KOG1282|consen  384 AWIKSL----NLSITDEWRPWYHKGGQVAGYTKTYGG-LTFATVRGAGHMVPYDKPESALIMFQRFLNGQPLPST  453 (454)
T ss_pred             HHHHhc----cCccccCccCCccCCCceeeeEEEecC-EEEEEEeCCcccCCCCCcHHHHHHHHHHHcCCCCCCC
Confidence            999985    57778999999995 899999999999 9999999999999999999999999999999999864



>PLN02213 sinapoylglucose-malate O-sinapoyltransferase/ carboxypeptidase Back     alignment and domain information
>PLN03016 sinapoylglucose-malate O-sinapoyltransferase Back     alignment and domain information
>PTZ00472 serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information
>PLN02209 serine carboxypeptidase Back     alignment and domain information
>PF00450 Peptidase_S10: Serine carboxypeptidase; InterPro: IPR001563 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG1283 consensus Serine carboxypeptidases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2939 Carboxypeptidase C (cathepsin A) [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>KOG4178 consensus Soluble epoxide hydrolase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PF08386 Abhydrolase_4: TAP-like protein; InterPro: IPR013595 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK06765 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>PF03583 LIP: Secretory lipase ; InterPro: IPR005152 This entry represents a family of secreted lipases Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>PF07519 Tannase: Tannase and feruloyl esterase; InterPro: IPR011118 This family includes fungal tannase [] and feruloyl esterase [, ] Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PLN02872 triacylglycerol lipase Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>COG0400 Predicted esterase [General function prediction only] Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>KOG2382 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query240
1gxs_B158 Crystal Structure Of Hydroxynitrile Lyase From Sorg 4e-27
1bcr_B160 Complex Of The Wheat Serine Carboxypeptidase, Cpdw- 3e-26
1wht_B153 Structure Of The Complex Of L-Benzylsuccinate With 3e-25
3sc2_B152 Refined Atomic Model Of Wheat Serine Carboxypeptida 3e-25
1whs_B153 Structure Of The Complex Of L-Benzylsuccinate With 3e-25
4az0_B155 Crystal Structure Of Cathepsin A, Complexed With 8a 3e-08
1ivy_A452 Physiological Dimer Hpp Precursor Length = 452 8e-08
1cpy_A421 Site-Directed Mutagenesis On (Serine) Carboxypeptid 3e-04
1wpx_A421 Crystal Structure Of Carboxypeptidase Y Inhibitor C 3e-04
>pdb|1GXS|B Chain B, Crystal Structure Of Hydroxynitrile Lyase From Sorghum Bicolor In Complex With Inhibitor Benzoic Acid: A Novel Cyanogenic Enzyme Length = 158 Back     alignment and structure

Iteration: 1

Score = 117 bits (294), Expect = 4e-27, Method: Compositional matrix adjust. Identities = 66/157 (42%), Positives = 93/157 (59%), Gaps = 9/157 (5%) Query: 79 DVCMTLERFFYLNLPEVQKALHANRTNL-PYGWSMCSGVLNYSDTDSNINILPVLKRIIQ 137 D C YLNLPEVQ ALHAN + + Y W++CS + + ++LPV + +IQ Sbjct: 5 DPCAVFNSINYLNLPEVQTALHANVSGIVEYPWTVCSNTIFDQWGQAADDLLPVYRELIQ 64 Query: 138 NGIPVWVFSGDQDSVVPLLGSRTLIRELARDLNFEVTVPYGAWFH---KQQVGGWGTEYG 194 G+ VWV+SGD DSVVP+ +R R LA L V + W+ +++VGGW +Y Sbjct: 65 AGLRVWVYSGDTDSVVPVSSTR---RSLAA-LELPVKTSWYPWYMAPTEREVGGWSVQYE 120 Query: 195 NLLTFVTVRGAAHMVPYAQPSRALHLFSSFVHGRRLP 231 LT+VTVRGA H+VP +P++A LF F+ G +P Sbjct: 121 G-LTYVTVRGAGHLVPVHRPAQAFLLFKQFLKGEPMP 156
>pdb|1BCR|B Chain B, Complex Of The Wheat Serine Carboxypeptidase, Cpdw-Ii, With The Microbial Peptide Aldehyde Inhibitor, Antipain, And Arginine At Room Temperature Length = 160 Back     alignment and structure
>pdb|1WHT|B Chain B, Structure Of The Complex Of L-Benzylsuccinate With Wheat Serine Carboxypeptidase Ii At 2.0 Angstroms Resolution Length = 153 Back     alignment and structure
>pdb|3SC2|B Chain B, Refined Atomic Model Of Wheat Serine Carboxypeptidase Ii At 2.2- Angstroms Resolution Length = 152 Back     alignment and structure
>pdb|1WHS|B Chain B, Structure Of The Complex Of L-Benzylsuccinate With Wheat Serine Carboxypeptidase Ii At 2.0 Angstroms Resolution Length = 153 Back     alignment and structure
>pdb|4AZ0|B Chain B, Crystal Structure Of Cathepsin A, Complexed With 8a. Length = 155 Back     alignment and structure
>pdb|1IVY|A Chain A, Physiological Dimer Hpp Precursor Length = 452 Back     alignment and structure
>pdb|1CPY|A Chain A, Site-Directed Mutagenesis On (Serine) Carboxypeptidase Y From Yeast. The Significance Of Thr 60 And Met 398 In Hydrolysis And Aminolysis Reactions Length = 421 Back     alignment and structure
>pdb|1WPX|A Chain A, Crystal Structure Of Carboxypeptidase Y Inhibitor Complexed With The Cognate Proteinase Length = 421 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query240
1whs_B153 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 2e-60
1gxs_B158 P-(S)-hydroxymandelonitrIle lyase chain B; inhibit 5e-60
1ivy_A452 Human protective protein; carboxypeptidase, serine 2e-57
1ac5_A483 KEX1(delta)P; carboxypeptidase, hydrolase, glycopr 2e-55
1cpy_A421 Serine carboxypeptidase; hydrolase (carboxypeptida 2e-50
1gxs_A270 P-(S)-hydroxymandelonitrIle lyase chain A; inhibit 2e-07
1whs_A255 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 1e-05
>1whs_B Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1wht_B* 1bcs_B* 1bcr_B* 3sc2_B* Length = 153 Back     alignment and structure
 Score =  186 bits (474), Expect = 2e-60
 Identities = 62/155 (40%), Positives = 85/155 (54%), Gaps = 6/155 (3%)

Query: 79  DVCMTLERFFYLNLPEVQKALHANRT-NLPYGWSMCSGVLNYSDTDSNINILPVLKRIIQ 137
           D C       Y N  +VQ ALHAN T  + Y W+ CS  +N    D+  ++LP+ + +I 
Sbjct: 3   DPCTERYSTAYYNRRDVQMALHANVTGAMNYTWATCSDTINTHWHDAPRSMLPIYRELIA 62

Query: 138 NGIPVWVFSGDQDSVVPLLGSRTLIRELARDLNFEVTVPYGAWFHKQQVGGWGTEYGNLL 197
            G+ +WVFSGD D+VVPL  +R  I      L    T  +  W+  Q+VGGW   Y   L
Sbjct: 63  AGLRIWVFSGDTDAVVPLTATRYSI----GALGLPTTTSWYPWYDDQEVGGWSQVYKG-L 117

Query: 198 TFVTVRGAAHMVPYAQPSRALHLFSSFVHGRRLPN 232
           T V+VRGA H VP  +P +AL LF  F+ G+ +P 
Sbjct: 118 TLVSVRGAGHEVPLHRPRQALVLFQYFLQGKPMPG 152


>1gxs_B P-(S)-hydroxymandelonitrIle lyase chain B; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Length = 158 Back     alignment and structure
>1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 Length = 452 Back     alignment and structure
>1ac5_A KEX1(delta)P; carboxypeptidase, hydrolase, glycoprotein, transmembrane; HET: NAG; 2.40A {Saccharomyces cerevisiae} SCOP: c.69.1.5 Length = 483 Back     alignment and structure
>1cpy_A Serine carboxypeptidase; hydrolase (carboxypeptidase); HET: NAG; 2.60A {Saccharomyces cerevisiae} SCOP: c.69.1.5 PDB: 1wpx_A* 1ysc_A* Length = 421 Back     alignment and structure
>1gxs_A P-(S)-hydroxymandelonitrIle lyase chain A; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Length = 270 Back     alignment and structure
>1whs_A Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1bcs_A* 1bcr_A* 1wht_A* 3sc2_A* Length = 255 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query240
1gxs_B158 P-(S)-hydroxymandelonitrIle lyase chain B; inhibit 100.0
1whs_B153 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 100.0
4az3_B155 Lysosomal protective protein 20 kDa chain; hydrola 100.0
1ivy_A452 Human protective protein; carboxypeptidase, serine 100.0
1cpy_A421 Serine carboxypeptidase; hydrolase (carboxypeptida 100.0
1ac5_A483 KEX1(delta)P; carboxypeptidase, hydrolase, glycopr 100.0
4az3_A300 Lysosomal protective protein 32 kDa chain; hydrola 98.71
1gxs_A270 P-(S)-hydroxymandelonitrIle lyase chain A; inhibit 97.56
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 97.43
1iup_A282 META-cleavage product hydrolase; aromatic compound 97.38
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 97.37
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 97.24
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 97.23
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 97.11
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 97.1
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 97.09
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 97.09
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 97.07
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 97.06
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 97.04
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 97.03
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 97.03
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 97.02
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 97.02
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 97.01
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 97.01
2pl5_A366 Homoserine O-acetyltransferase; alpha/beta hydrola 97.0
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 96.95
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 96.93
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 96.9
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 96.89
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 96.86
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 96.86
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 96.83
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 96.83
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 96.83
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 96.81
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 96.81
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 96.8
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 96.79
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 96.78
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 96.74
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 96.71
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 96.69
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 96.69
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 96.68
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 96.68
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 96.66
3afi_E316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 96.66
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 96.65
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 96.64
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 96.64
4dnp_A269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 96.62
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 96.62
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 96.62
2y6u_A398 Peroxisomal membrane protein LPX1; hydrolase, puta 96.61
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 96.6
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 96.59
2e3j_A356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 96.57
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 96.56
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 96.54
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 96.52
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 96.51
2b61_A377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 96.5
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 96.48
3i1i_A377 Homoserine O-acetyltransferase; structural genomic 96.47
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 96.45
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 96.44
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 96.4
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 96.39
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 96.34
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 96.33
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 96.3
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 96.28
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 96.27
1wm1_A317 Proline iminopeptidase; complex with inhibitor, hy 96.26
2vat_A444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 96.26
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 96.13
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 96.07
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 96.07
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 96.06
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 96.05
3llc_A270 Putative hydrolase; structural genomics, joint cen 95.93
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 95.92
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 95.87
3h04_A275 Uncharacterized protein; protein with unknown func 95.87
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 95.86
4g9e_A279 AHL-lactonase, alpha/beta hydrolase fold protein; 95.85
3i28_A555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 95.85
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 95.84
2psd_A318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 95.77
3c5v_A316 PME-1, protein phosphatase methylesterase 1; demet 95.76
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 95.76
1pja_A302 Palmitoyl-protein thioesterase 2 precursor; hydrol 95.72
1k8q_A377 Triacylglycerol lipase, gastric; APHA beta hydrola 95.7
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 95.66
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 95.56
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 95.53
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 95.42
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 95.37
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 94.33
1azw_A313 Proline iminopeptidase; aminopeptidase, serine pro 95.34
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 95.34
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 95.32
1vkh_A273 Putative serine hydrolase; structural genomics, jo 95.31
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 95.17
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 95.16
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 94.97
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 94.95
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 94.92
4f21_A246 Carboxylesterase/phospholipase family protein; str 94.7
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 94.69
1qlw_A328 Esterase; anisotropic refinement, atomic resolutio 94.67
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 94.62
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 94.61
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 94.61
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 94.58
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 94.55
1r3d_A264 Conserved hypothetical protein VC1974; structural 94.51
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 94.46
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 94.37
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 94.18
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 94.08
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 93.98
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 93.91
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 93.9
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 93.47
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 93.45
3bjr_A283 Putative carboxylesterase; structural genomics, jo 93.32
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 93.31
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 93.3
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 93.18
1ycd_A243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 93.06
2d81_A 318 PHB depolymerase; alpha/beta hydrolase fold, circu 93.06
4fle_A202 Esterase; structural genomics, PSI-biology, northe 92.96
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 92.91
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 92.7
2o7r_A338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 92.65
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 92.6
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 92.58
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 92.58
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 92.25
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 91.76
2wj6_A276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 91.41
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 91.24
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 91.1
3ils_A265 PKS, aflatoxin biosynthesis polyketide synthase; A 90.83
4i19_A388 Epoxide hydrolase; structural genomics, PSI-biolog 90.82
3fnb_A405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 90.65
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 90.47
3pic_A375 CIP2; alpha/beta hydrolase fold, glucuronoyl ester 90.22
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 89.88
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 89.49
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 88.97
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 88.95
3guu_A462 Lipase A; protein structure, hydrolase; HET: 1PE; 88.86
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 88.53
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 88.47
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 88.25
1kez_A300 Erythronolide synthase; polyketide synthase, modul 88.1
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 88.0
4g4g_A433 4-O-methyl-glucuronoyl methylesterase; alpha/beta 87.98
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 87.98
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 87.45
1jmk_C230 SRFTE, surfactin synthetase; thioesterase, non-rib 87.02
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 86.66
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 86.32
1jkm_A361 Brefeldin A esterase; serine hydrolase, degradatio 85.97
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 85.86
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 83.98
2qru_A274 Uncharacterized protein; alpha/beta-hydrolase, str 82.86
3lp5_A250 Putative cell surface hydrolase; structural genom 80.97
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 80.28
>1gxs_B P-(S)-hydroxymandelonitrIle lyase chain B; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Back     alignment and structure
Probab=100.00  E-value=1.8e-48  Score=313.28  Aligned_cols=151  Identities=42%  Similarity=0.824  Sum_probs=137.0

Q ss_pred             CcCCCcchhhhhccCcHHHHHhhCCCCCC-CCCccccccccccccCCCcccccHHHHHHHHhCCccEEEEecCCcccCCc
Q 026319           77 GVDVCMTLERFFYLNLPEVQKALHANRTN-LPYGWSMCSGVLNYSDTDSNINILPVLKRIIQNGIPVWVFSGDQDSVVPL  155 (240)
Q Consensus        77 ~~~~C~~~~~~~ylN~~~V~~aLhv~~~~-~~~~w~~cs~~v~~~~~d~~~~~~~~~~~Ll~~~irVLiY~Gd~D~~~~~  155 (240)
                      .+++|.+..++.|||+++||+||||+... ++.+|+.||+.|...+.|.+.++++.++.||++|+|||||+||+|++||+
T Consensus         3 ~~~~C~~~~~~~ylN~~~V~~ALhv~~~~~~~~~w~~Cs~~V~~~~~d~~~~~~~~~~~Ll~~girVliysGd~D~i~~~   82 (158)
T 1gxs_B            3 PYDPCAVFNSINYLNLPEVQTALHANVSGIVEYPWTVCSNTIFDQWGQAADDLLPVYRELIQAGLRVWVYSGDTDSVVPV   82 (158)
T ss_dssp             CCCTTTHHHHHHHHTCHHHHHHHTCSGGGCSCSCCCSBCHHHHHTCCCCCSBCHHHHHHHHHTTCEEEEEEETTCSSSCH
T ss_pred             CCCCcccchHHHHcCCHHHHHHhCCCCCCCcCCCceeCCHHHHhhhhhccccHHHHHHHHHHcCCeEEEEecccCccCCc
Confidence            46899988889999999999999998632 22369999998875566778999999999999999999999999999999


Q ss_pred             hhHHHHHHHHHhccCCcccccccceeeC---CEEeEEEEEeCCeEEEEEEcCCCccCCCCChHHHHHHHHHHHCCCCCCC
Q 026319          156 LGSRTLIRELARDLNFEVTVPYGAWFHK---QQVGGWGTEYGNLLTFVTVRGAAHMVPYAQPSRALHLFSSFVHGRRLPN  232 (240)
Q Consensus       156 ~g~~~~i~~l~w~~~~~~~~~~~~w~~~---~~v~G~~~~~~~~Ltf~~V~~AGHmvP~dqP~~a~~~~~~fi~g~~~~~  232 (240)
                      .||++|+++|+|+    ..++|++|+++   +++|||+++|+| |||++|+|||||||+|||++|++||++||.|+++|+
T Consensus        83 ~Gt~~wi~~L~w~----~~~~~~~w~~~~~~~~vaG~~~~~~n-Ltf~~V~~AGHmVP~dqP~~al~m~~~fl~g~~l~~  157 (158)
T 1gxs_B           83 SSTRRSLAALELP----VKTSWYPWYMAPTEREVGGWSVQYEG-LTYVTVRGAGHLVPVHRPAQAFLLFKQFLKGEPMPA  157 (158)
T ss_dssp             HHHHHHHHTTCCC----EEEEEEEEESSTTCCSEEEEEEEETT-EEEEEETTCCSSHHHHCHHHHHHHHHHHHHTCCCCC
T ss_pred             HHHHHHHHHCCCc----ccCCccceEECCCCCcccceEEEeCC-EEEEEECCCcccCcccCcHHHHHHHHHHHcCCCCCC
Confidence            9999999997554    46889999998   999999999999 999999999999999999999999999999999975



>1whs_B Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1wht_B* 1bcs_B* 1bcr_B* 3sc2_B* Back     alignment and structure
>4az3_B Lysosomal protective protein 20 kDa chain; hydrolase, drug discovery, carboxypeptidase, cardiovascular; HET: NAG S35; 2.04A {Homo sapiens} PDB: 4az0_B* Back     alignment and structure
>1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 Back     alignment and structure
>1cpy_A Serine carboxypeptidase; hydrolase (carboxypeptidase); HET: NAG; 2.60A {Saccharomyces cerevisiae} SCOP: c.69.1.5 PDB: 1wpx_A* 1ysc_A* Back     alignment and structure
>1ac5_A KEX1(delta)P; carboxypeptidase, hydrolase, glycoprotein, transmembrane; HET: NAG; 2.40A {Saccharomyces cerevisiae} SCOP: c.69.1.5 Back     alignment and structure
>4az3_A Lysosomal protective protein 32 kDa chain; hydrolase, drug discovery, carboxypeptidase, cardiovascular; HET: NAG S35; 2.04A {Homo sapiens} PDB: 4az0_A* Back     alignment and structure
>1gxs_A P-(S)-hydroxymandelonitrIle lyase chain A; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A* Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>3pic_A CIP2; alpha/beta hydrolase fold, glucuronoyl esterase, carbohydrat esterase family 15 (CE-15), N-linked glycosylation, secrete hydrolase; HET: NAG; 1.90A {Hypocrea jecorina} Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>4g4g_A 4-O-methyl-glucuronoyl methylesterase; alpha/beta hydrolase, 3-layer alpha/beta/alpha sandwich, ROS fold, glucuronoyl esterase; 1.55A {Myceliophthora thermophila} PDB: 4g4i_A 4g4j_A* Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 240
g1gxs.1425 c.69.1.5 (A:,B:) Hydroxynitrile lyase {Sorghum (So 1e-42
g1wht.1409 c.69.1.5 (A:,B:) Serine carboxypeptidase II {Wheat 6e-41
d1ivya_452 c.69.1.5 (A:) Human 'protective protein', HPP {Hum 3e-38
d1ac5a_483 c.69.1.5 (A:) Serine carboxypeptidase II {Baker's 1e-34
d1wpxa1421 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Bak 1e-32
>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Length = 452 Back     information, alignment and structure
>d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} Length = 483 Back     information, alignment and structure
>d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 421 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query240
g1wht.1409 Serine carboxypeptidase II {Wheat (Triticum vulgar 100.0
g1gxs.1425 Hydroxynitrile lyase {Sorghum (Sorghum bicolor) [T 100.0
d1ivya_452 Human 'protective protein', HPP {Human (Homo sapie 100.0
d1ac5a_483 Serine carboxypeptidase II {Baker's yeast (Sacchar 100.0
d1wpxa1421 Serine carboxypeptidase II {Baker's yeast (Sacchar 100.0
d1ehya_293 Bacterial epoxide hydrolase {Agrobacterium radioba 97.69
d1a8sa_273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 97.56
d1j1ia_268 Meta cleavage compound hydrolase CarC {Janthinobac 97.48
d1bn7a_291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 97.48
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 97.48
d1a88a_275 Chloroperoxidase L {Streptomyces lividans [TaxId: 97.37
d1va4a_271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 97.34
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 97.33
d1q0ra_297 Aclacinomycin methylesterase RdmC {Streptomyces pu 97.24
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 97.23
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 97.2
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 97.18
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 97.1
d1zd3a2322 Mammalian epoxide hydrolase, C-terminal domain {Hu 97.06
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 97.0
d1m33a_256 Biotin biosynthesis protein BioH {Escherichia coli 96.97
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 96.94
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 96.89
d1b6ga_310 Haloalkane dehalogenase {Xanthobacter autotrophicu 96.85
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 96.71
d1l7aa_318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 96.58
d1ufoa_238 Hypothetical protein TT1662 {Thermus thermophilus 96.22
d1r3da_264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 96.01
d1qlwa_318 A novel bacterial esterase {Alcaligenes sp. [TaxId 95.94
d1azwa_313 Proline iminopeptidase {Xanthomonas campestris, pv 95.91
d1mj5a_298 Haloalkane dehalogenase {Sphingomonas paucimobilis 95.9
d1wm1a_313 Proline aminopeptidase {Serratia marcescens [TaxId 95.54
d1k8qa_377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 95.34
d1qfma2280 Prolyl oligopeptidase, C-terminal domain {Pig (Sus 94.95
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 94.62
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 94.45
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 92.91
d1pjaa_268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 92.76
d2i3da1218 Hypothetical protein Atu1826 {Agrobacterium tumefa 92.16
d2hu7a2260 Acylamino-acid-releasing enzyme, C-terminal donain 91.86
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 91.74
d1auoa_218 Carboxylesterase {Pseudomonas fluorescens [TaxId: 91.66
d1qo7a_394 Bacterial epoxide hydrolase {Aspergillus niger [Ta 91.45
d2d81a1 318 Polyhydroxybutyrate depolymerase {Penicillium funi 89.94
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 89.68
d1thta_302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 89.53
d1jfra_260 Lipase {Streptomyces exfoliatus [TaxId: 1905]} 89.49
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 89.25
d1vlqa_322 Acetyl xylan esterase TM0077 {Thermotoga maritima 88.89
d2bgra2258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 88.88
d1xfda2258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 88.87
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 87.44
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 86.87
d1vkha_263 Putative serine hydrolase Ydr428c {Baker's yeast ( 81.83
>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} Back     information, alignment and structure
>d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure