Citrus Sinensis ID: 026327


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240
MELQQKFYGIFKGTVEKITSHRTVSAFKEKGVLSVSEFVLAGDNLVSKCPTWSWESGEPSKRKSYLPADKQFLITRNVPCLRRAASVEEEYEGAGGEILVDNEDNDGWLATHGKPKAKCDEDEDDNLPSMEAVEISKNNNVRAISTYFGGEEEEEEDIPDMAEYNEPDSIIENETDPATLPSTYLVAHEPDDDNILRTRTYDISITYDKYYQTPRVWLTGYDEVSYLDLHLSWWLSLFFL
cHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccEEEEEccccHHHHHHHHHHHcccccccEEEccccccccEEcccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEccccccccccEEEECccccccccHHHHHHHHHcc
*****KFYGIFKGTVEKITSHRTVSAFKEKGVLSVSEFVLAGDNLVSKCPTWSWESGEPSKRKSYLPADKQFLITRNVPCLRRAASVEEEYEGAGGEILVDNEDNDGWLATH*********************************************IPDMAEYNEPDSIIENETDPATLPSTYLVAHEPDDDNILRTRTYDISITYDKYYQTPRVWLTGYDEVSYLDLHLSWWLSLFFL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MELQQKFYGIFKGTVEKITSHRTVSAFKEKGVLSVSEFVLAGDNLVSKCPTWSWESGEPSKRKSYLPADKQFLITRNVPCLRRAASVEEEYEGAGGEILVDNEDNDGWLATHGKPKAKCDEDEDDNLPSMEAVEISKNNNVRAISTYFGGEEEEEEDIPDMAEYNEPDSIIENETDPATLPSTYLVAHEPDDDNILRTRTYDISITYDKYYQTPRVWLTGYDEVSYLDLHLSWWLSLFFL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Autophagy-related protein 3 E2 conjugating enzyme responsible for the E2-like covalent binding of phosphatidylethanolamine to the C-terminal Gly of ATG8. This step is required for the membrane association of ATG8. The formation of the ATG8-phosphatidylethanolamine conjugate is essential for autophagy and for the cytoplasm to vacuole transport (Cvt).probableQ0WWQ1

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3VX8, chain B
Confidence level:very confident
Coverage over the Query: 26-87
View the alignment between query and template
View the model in PyMOL
Template: 2DYT, chain A
Confidence level:very confident
Coverage over the Query: 26-87,127-131,151-158,194-234
View the alignment between query and template
View the model in PyMOL