Citrus Sinensis ID: 026342


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240
MAPQIDSARRRMTAVANHLVPVISSDSNSGFIGLNNASMNDSYHRIHGEVPSHDVVWRIACDESGTEFTDIIYEKAVGEGIAKITINRPDRRNAFRPHTVKELIRAFNDARDDSSVGVIILTGKGTEAFCSGGDQALRTRDGYADYENFGRLNVLDLQVQIRRLPKPVIAMVAGYAVGGGHVLHMVCDLTIAADNAIFGQTGPKVGSFDAGYGSSIMSRLVSTVQQCLWWGLKKHVKCGF
ccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccECcccccccccccEEEEEEccccEEEEEEccccccccccHHHHHHHHHHHHHHcccccccEEEEEcccccccccccccHHHccccccHHHHHccccHHHHHHHHHcccccEEEEEccEEccHHHHHHHHHHHHHHccccccccccccECcccccccHHHHHHHHcHHHHHHHHcHHccccccc
**********RMTAVANHL****************************GEVPSHDVVWRIACDESGTEFTDIIYEKAVGEGIAKITINRPDRRNAFRPHTVKELIRAFNDARDDSSVGVIILTGKGTEAFCSGGDQALRTRDGYADYENFGRLNVLDLQVQIRRLPKPVIAMVAGYAVGGGHVLHMVCDLTIAADNAIFGQTGPKVGSFDAGYGSSIMSRLVSTVQQCLWWGLKKHVKCGF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAPQIDSARRRMTAVANHLVPVISSDSNSGFIGLNNASMNDSYHRIHGEVPSHDVVWRIACDESGTEFTDIIYEKAVGEGIAKITINRPDRRNAFRPHTVKELIRAFNDARDDSSVGVIILTGKGTEAFCSGGDQALRTRDGYADYENFGRLNVLDLQVQIRRLPKPVIAMVAGYAVGGGHVLHMVCDLTIAADNAIFGQTGPKVGSFDAGYGSSIMSRLVSTVQQCLWWGLKKHVKCGF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
1,4-Dihydroxy-2-naphthoyl-CoA synthase, peroxisomal Involved in the biosynthesis of phylloquinone (vitamin K1). Converts o-succinylbenzoyl-CoA (OSB-CoA) to 1,4-dihydroxy-2-naphthoyl-CoA (DHNA-CoA).probableQ8GYN9
1,4-Dihydroxy-2-naphthoyl-CoA synthase Converts o-succinylbenzoyl-CoA (OSB-CoA) to 1,4-dihydroxy-2-naphthoyl-CoA (DHNA-CoA).probableQ4L549
1,4-Dihydroxy-2-naphthoyl-CoA synthase Converts o-succinylbenzoyl-CoA (OSB-CoA) to 1,4-dihydroxy-2-naphthoyl-CoA (DHNA-CoA).probableQ49WG8

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4EML, chain A
Confidence level:very confident
Coverage over the Query: 67-136,151-238
View the alignment between query and template
View the model in PyMOL
Template: 3H02, chain A
Confidence level:confident
Coverage over the Query: 42-135,150-235
View the alignment between query and template
View the model in PyMOL