Citrus Sinensis ID: 026342
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 240 | ||||||
| 225425573 | 336 | PREDICTED: 1,4-Dihydroxy-2-naphthoyl-CoA | 0.933 | 0.666 | 0.776 | 5e-99 | |
| 147771137 | 336 | hypothetical protein VITISV_034257 [Viti | 0.933 | 0.666 | 0.776 | 8e-99 | |
| 255568782 | 335 | Naphthoate synthase, putative [Ricinus c | 0.962 | 0.689 | 0.753 | 3e-97 | |
| 307135970 | 333 | naphthoate synthase [Cucumis melo subsp. | 0.933 | 0.672 | 0.773 | 5e-97 | |
| 449517563 | 333 | PREDICTED: 1,4-Dihydroxy-2-naphthoyl-CoA | 0.933 | 0.672 | 0.764 | 4e-96 | |
| 449434935 | 333 | PREDICTED: 1,4-Dihydroxy-2-naphthoyl-CoA | 0.933 | 0.672 | 0.76 | 5e-95 | |
| 359806589 | 339 | uncharacterized protein LOC100807101 [Gl | 0.962 | 0.681 | 0.722 | 3e-93 | |
| 297837457 | 337 | hypothetical protein ARALYDRAFT_475277 [ | 0.962 | 0.685 | 0.714 | 8e-92 | |
| 30696431 | 337 | naphthoate synthase [Arabidopsis thalian | 0.962 | 0.685 | 0.714 | 9e-92 | |
| 259490362 | 336 | uncharacterized protein LOC100304279 [Ze | 0.958 | 0.684 | 0.715 | 9e-92 |
| >gi|225425573|ref|XP_002267500.1| PREDICTED: 1,4-Dihydroxy-2-naphthoyl-CoA synthase, peroxisomal [Vitis vinifera] gi|297739062|emb|CBI28551.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 366 bits (939), Expect = 5e-99, Method: Compositional matrix adjust.
Identities = 174/224 (77%), Positives = 194/224 (86%)
Query: 7 SARRRMTAVANHLVPVISSDSNSGFIGLNNASMNDSYHRIHGEVPSHDVVWRIACDESGT 66
+ARRR+ +VA+HL P+ S+ N +G + S DSY R+HGEVP+HDV W ACDESG
Sbjct: 12 NARRRLASVAHHLTPLHSTTPNCSSLGFHTTSAPDSYRRVHGEVPTHDVTWNPACDESGK 71
Query: 67 EFTDIIYEKAVGEGIAKITINRPDRRNAFRPHTVKELIRAFNDARDDSSVGVIILTGKGT 126
FTDIIYEKAVGE IAKITINRP+RRNAFRP+TVKELIRAFNDARDDSSVGVII TGKGT
Sbjct: 72 AFTDIIYEKAVGEAIAKITINRPERRNAFRPNTVKELIRAFNDARDDSSVGVIIFTGKGT 131
Query: 127 EAFCSGGDQALRTRDGYADYENFGRLNVLDLQVQIRRLPKPVIAMVAGYAVGGGHVLHMV 186
+AFCSGGDQA R RDGYAD+++FGRLNVLDLQ+QIRRLPKPVIAMVAGYAVGGGHVLHMV
Sbjct: 132 KAFCSGGDQAFRGRDGYADHDDFGRLNVLDLQMQIRRLPKPVIAMVAGYAVGGGHVLHMV 191
Query: 187 CDLTIAADNAIFGQTGPKVGSFDAGYGSSIMSRLVSTVQQCLWW 230
CDLTIAADNAIFGQTGPKVGSFD+GYGSSIMSRL+ + W
Sbjct: 192 CDLTIAADNAIFGQTGPKVGSFDSGYGSSIMSRLIGPKKAREMW 235
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|147771137|emb|CAN74179.1| hypothetical protein VITISV_034257 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255568782|ref|XP_002525362.1| Naphthoate synthase, putative [Ricinus communis] gi|223535325|gb|EEF37000.1| Naphthoate synthase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|307135970|gb|ADN33829.1| naphthoate synthase [Cucumis melo subsp. melo] | Back alignment and taxonomy information |
|---|
| >gi|449517563|ref|XP_004165815.1| PREDICTED: 1,4-Dihydroxy-2-naphthoyl-CoA synthase, peroxisomal-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449434935|ref|XP_004135251.1| PREDICTED: 1,4-Dihydroxy-2-naphthoyl-CoA synthase, peroxisomal-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|359806589|ref|NP_001241269.1| uncharacterized protein LOC100807101 [Glycine max] gi|255639630|gb|ACU20109.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297837457|ref|XP_002886610.1| hypothetical protein ARALYDRAFT_475277 [Arabidopsis lyrata subsp. lyrata] gi|297332451|gb|EFH62869.1| hypothetical protein ARALYDRAFT_475277 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|30696431|ref|NP_176255.2| naphthoate synthase [Arabidopsis thaliana] gi|327488386|sp|Q8GYN9.2|MENB_ARATH RecName: Full=1,4-Dihydroxy-2-naphthoyl-CoA synthase, peroxisomal; Short=DHNS; AltName: Full=Enoyl-CoA hydratase/isomerase D; Short=ECHID; AltName: Full=Naphthoate synthase gi|192571726|gb|ACF04808.1| At1g60550 [Arabidopsis thaliana] gi|332195575|gb|AEE33696.1| naphthoate synthase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|259490362|ref|NP_001159194.1| uncharacterized protein LOC100304279 [Zea mays] gi|223942561|gb|ACN25364.1| unknown [Zea mays] gi|414881113|tpg|DAA58244.1| TPA: hypothetical protein ZEAMMB73_624046 [Zea mays] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 240 | ||||||
| TAIR|locus:2036626 | 337 | ECHID "enoyl-CoA hydratase/iso | 0.945 | 0.673 | 0.727 | 8.9e-86 | |
| UNIPROTKB|P0ABU0 | 285 | menB [Escherichia coli K-12 (t | 0.675 | 0.568 | 0.666 | 1.7e-52 | |
| TIGR_CMR|BA_5109 | 272 | BA_5109 "naphthoate synthase" | 0.633 | 0.558 | 0.688 | 7.2e-52 | |
| UNIPROTKB|P23966 | 271 | menB "1,4-Dihydroxy-2-naphthoy | 0.633 | 0.560 | 0.675 | 1.9e-51 | |
| UNIPROTKB|Q9KQM5 | 296 | VC_1973 "Naphthoate synthase" | 0.675 | 0.547 | 0.648 | 2.5e-49 | |
| TIGR_CMR|VC_1973 | 296 | VC_1973 "naphthoate synthase" | 0.675 | 0.547 | 0.648 | 2.5e-49 | |
| TIGR_CMR|SO_4739 | 300 | SO_4739 "naphthoate synthase" | 0.658 | 0.526 | 0.508 | 1.5e-37 | |
| UNIPROTKB|A0QRD3 | 309 | menB "1,4-Dihydroxy-2-naphthoy | 0.570 | 0.443 | 0.493 | 2e-31 | |
| UNIPROTKB|O06414 | 314 | menB "1,4-Dihydroxy-2-naphthoy | 0.562 | 0.429 | 0.457 | 3.4e-29 | |
| TIGR_CMR|GSU_1377 | 260 | GSU_1377 "3-hydroxybutyryl-CoA | 0.6 | 0.553 | 0.406 | 5.7e-20 |
| TAIR|locus:2036626 ECHID "enoyl-CoA hydratase/isomerase D" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 858 (307.1 bits), Expect = 8.9e-86, P = 8.9e-86
Identities = 168/231 (72%), Positives = 194/231 (83%)
Query: 4 QIDSARRRMTAVANHLVPVISSDSNSGFIGLNNAS-MNDSYHRIHGEVPSHDVVWR---I 59
++ SA RR++ V NHL+P+ S + + + L +AS M+D +H++HGEVP+H+VVW+
Sbjct: 6 ELGSASRRLSVVTNHLIPIGFSPARADSVELCSASSMDDRFHKVHGEVPTHEVVWKKTDF 65
Query: 60 ACDESGTEFTDIIYEKAVGEGIAKITINRPDRRNAFRPHTVKELIRAFNDARDDSSVGVI 119
+ EF DIIYEKA+ EGIAKITINRP+RRNAFRP TVKEL+RAFNDARDDSSVGVI
Sbjct: 66 FGEGDNKEFVDIIYEKALDEGIAKITINRPERRNAFRPQTVKELMRAFNDARDDSSVGVI 125
Query: 120 ILTGKGTEAFCSGGDQALRTRDGYADYENFGRLNVLDLQVQIRRLPKPVIAMVAGYAVGG 179
ILTGKGT+AFCSGGDQALRT+DGYAD + GRLNVLDLQVQIRRLPKPVIAMVAGYAVGG
Sbjct: 126 ILTGKGTKAFCSGGDQALRTQDGYADPNDVGRLNVLDLQVQIRRLPKPVIAMVAGYAVGG 185
Query: 180 GHVLHMVCDLTIAADNAIFGQTGPKVGSFDAGYGSSIMSRLVSTVQQCLWW 230
GH+LHMVCDLTIAADNAIFGQTGPKVGSFDAGYGSSIMSRLV + W
Sbjct: 186 GHILHMVCDLTIAADNAIFGQTGPKVGSFDAGYGSSIMSRLVGPKKAREMW 236
|
|
| UNIPROTKB|P0ABU0 menB [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|BA_5109 BA_5109 "naphthoate synthase" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P23966 menB "1,4-Dihydroxy-2-naphthoyl-CoA synthase" [Bacillus subtilis subsp. subtilis str. 168 (taxid:224308)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9KQM5 VC_1973 "Naphthoate synthase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|VC_1973 VC_1973 "naphthoate synthase" [Vibrio cholerae O1 biovar El Tor (taxid:686)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SO_4739 SO_4739 "naphthoate synthase" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A0QRD3 menB "1,4-Dihydroxy-2-naphthoyl-CoA synthase" [Mycobacterium smegmatis str. MC2 155 (taxid:246196)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O06414 menB "1,4-Dihydroxy-2-naphthoyl-CoA synthase" [Mycobacterium tuberculosis (taxid:1773)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_1377 GSU_1377 "3-hydroxybutyryl-CoA dehydratase" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00002734001 | SubName- Full=Chromosome chr1 scaffold_135, whole genome shotgun sequence; (336 aa) | ||||||||||
(Vitis vinifera) | |||||||||||
| GSVIVG00021178001 | • | • | • | • | 0.974 | ||||||
| GSVIVG00029748001 | • | • | • | • | 0.928 | ||||||
| GSVIVG00000099001 | • | • | • | 0.916 | |||||||
| GSVIVG00027718001 | • | • | • | • | 0.856 | ||||||
| GSVIVG00019735001 | • | • | • | 0.774 | |||||||
| GSVIVG00024504001 | • | • | • | 0.715 | |||||||
| GSVIVG00036606001 | • | • | • | 0.629 | |||||||
| GSVIVG00002760001 | • | 0.595 | |||||||||
| GSVIVG00034896001 | • | • | 0.551 | ||||||||
| GSVIVG00029076001 | • | • | 0.547 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 240 | |||
| PLN02921 | 327 | PLN02921, PLN02921, naphthoate synthase | 1e-143 | |
| PRK07396 | 273 | PRK07396, PRK07396, dihydroxynaphthoic acid synthe | 1e-108 | |
| COG0447 | 282 | COG0447, MenB, Dihydroxynaphthoic acid synthase [C | 6e-92 | |
| TIGR01929 | 259 | TIGR01929, menB, naphthoate synthase (dihydroxynap | 9e-84 | |
| PRK08321 | 302 | PRK08321, PRK08321, naphthoate synthase; Validated | 2e-67 | |
| TIGR03210 | 256 | TIGR03210, badI, 2-ketocyclohexanecarboxyl-CoA hyd | 7e-53 | |
| pfam00378 | 245 | pfam00378, ECH, Enoyl-CoA hydratase/isomerase fami | 6e-45 | |
| cd06558 | 195 | cd06558, crotonase-like, Crotonase/Enoyl-Coenzyme | 1e-44 | |
| COG1024 | 257 | COG1024, CaiD, Enoyl-CoA hydratase/carnithine race | 1e-36 | |
| PRK06688 | 259 | PRK06688, PRK06688, enoyl-CoA hydratase; Provision | 5e-30 | |
| PRK05995 | 262 | PRK05995, PRK05995, enoyl-CoA hydratase; Provision | 1e-28 | |
| PRK05809 | 260 | PRK05809, PRK05809, 3-hydroxybutyryl-CoA dehydrata | 2e-27 | |
| PRK06494 | 259 | PRK06494, PRK06494, enoyl-CoA hydratase; Provision | 2e-26 | |
| PRK05862 | 257 | PRK05862, PRK05862, enoyl-CoA hydratase; Provision | 3e-24 | |
| TIGR03200 | 360 | TIGR03200, dearomat_oah, 6-oxocyclohex-1-ene-1-car | 1e-23 | |
| PRK06127 | 269 | PRK06127, PRK06127, enoyl-CoA hydratase; Provision | 3e-23 | |
| PRK07511 | 260 | PRK07511, PRK07511, enoyl-CoA hydratase; Provision | 3e-23 | |
| PRK08290 | 288 | PRK08290, PRK08290, enoyl-CoA hydratase; Provision | 9e-23 | |
| PRK06144 | 262 | PRK06144, PRK06144, enoyl-CoA hydratase; Provision | 2e-22 | |
| PRK08260 | 296 | PRK08260, PRK08260, enoyl-CoA hydratase; Provision | 3e-22 | |
| PRK07657 | 260 | PRK07657, PRK07657, enoyl-CoA hydratase; Provision | 6e-22 | |
| PRK07468 | 262 | PRK07468, PRK07468, enoyl-CoA hydratase; Provision | 7e-22 | |
| PRK08140 | 262 | PRK08140, PRK08140, enoyl-CoA hydratase; Provision | 9e-22 | |
| PRK08138 | 261 | PRK08138, PRK08138, enoyl-CoA hydratase; Provision | 1e-21 | |
| PRK09120 | 275 | PRK09120, PRK09120, p-hydroxycinnamoyl CoA hydrata | 1e-21 | |
| PRK06210 | 272 | PRK06210, PRK06210, enoyl-CoA hydratase; Provision | 1e-21 | |
| PRK08139 | 266 | PRK08139, PRK08139, enoyl-CoA hydratase; Validated | 3e-21 | |
| PRK09245 | 266 | PRK09245, PRK09245, enoyl-CoA hydratase; Provision | 4e-21 | |
| PLN02888 | 265 | PLN02888, PLN02888, enoyl-CoA hydratase | 1e-20 | |
| PRK08272 | 302 | PRK08272, PRK08272, enoyl-CoA hydratase; Provision | 6e-20 | |
| PRK03580 | 261 | PRK03580, PRK03580, carnitinyl-CoA dehydratase; Pr | 2e-19 | |
| PRK07110 | 249 | PRK07110, PRK07110, polyketide biosynthesis enoyl- | 5e-19 | |
| PRK05870 | 249 | PRK05870, PRK05870, enoyl-CoA hydratase; Provision | 6e-19 | |
| PRK08259 | 254 | PRK08259, PRK08259, enoyl-CoA hydratase; Provision | 1e-18 | |
| PRK06190 | 258 | PRK06190, PRK06190, enoyl-CoA hydratase; Provision | 1e-18 | |
| TIGR02280 | 256 | TIGR02280, PaaB1, phenylacetate degradation probab | 2e-18 | |
| PRK09674 | 255 | PRK09674, PRK09674, enoyl-CoA hydratase-isomerase; | 3e-18 | |
| PRK05864 | 276 | PRK05864, PRK05864, enoyl-CoA hydratase; Provision | 7e-18 | |
| PRK07854 | 243 | PRK07854, PRK07854, enoyl-CoA hydratase; Provision | 1e-17 | |
| PRK08252 | 254 | PRK08252, PRK08252, enoyl-CoA hydratase; Provision | 3e-17 | |
| PRK08258 | 277 | PRK08258, PRK08258, enoyl-CoA hydratase; Provision | 3e-17 | |
| PRK05980 | 260 | PRK05980, PRK05980, enoyl-CoA hydratase; Provision | 6e-17 | |
| PRK06142 | 272 | PRK06142, PRK06142, enoyl-CoA hydratase; Provision | 1e-16 | |
| PRK05674 | 265 | PRK05674, PRK05674, gamma-carboxygeranoyl-CoA hydr | 5e-16 | |
| PRK07827 | 260 | PRK07827, PRK07827, enoyl-CoA hydratase; Provision | 1e-15 | |
| PRK07799 | 263 | PRK07799, PRK07799, enoyl-CoA hydratase; Provision | 2e-15 | |
| PRK07658 | 257 | PRK07658, PRK07658, enoyl-CoA hydratase; Provision | 2e-15 | |
| PRK07260 | 255 | PRK07260, PRK07260, enoyl-CoA hydratase; Provision | 7e-15 | |
| PRK11423 | 261 | PRK11423, PRK11423, methylmalonyl-CoA decarboxylas | 2e-14 | |
| PRK06495 | 257 | PRK06495, PRK06495, enoyl-CoA hydratase; Provision | 4e-14 | |
| PRK07509 | 262 | PRK07509, PRK07509, enoyl-CoA hydratase; Provision | 5e-14 | |
| PLN02600 | 251 | PLN02600, PLN02600, enoyl-CoA hydratase | 7e-14 | |
| PRK12478 | 298 | PRK12478, PRK12478, enoyl-CoA hydratase; Provision | 9e-14 | |
| PRK05981 | 266 | PRK05981, PRK05981, enoyl-CoA hydratase; Provision | 2e-13 | |
| PRK07327 | 268 | PRK07327, PRK07327, enoyl-CoA hydratase; Provision | 2e-13 | |
| PRK06143 | 256 | PRK06143, PRK06143, enoyl-CoA hydratase; Provision | 3e-12 | |
| PRK06563 | 255 | PRK06563, PRK06563, enoyl-CoA hydratase; Provision | 3e-12 | |
| PRK08150 | 255 | PRK08150, PRK08150, enoyl-CoA hydratase; Provision | 6e-12 | |
| PRK06023 | 251 | PRK06023, PRK06023, enoyl-CoA hydratase; Provision | 7e-12 | |
| PRK05869 | 222 | PRK05869, PRK05869, enoyl-CoA hydratase; Validated | 9e-12 | |
| PRK07659 | 260 | PRK07659, PRK07659, enoyl-CoA hydratase; Provision | 2e-11 | |
| PRK06072 | 248 | PRK06072, PRK06072, enoyl-CoA hydratase; Provision | 2e-11 | |
| PLN02664 | 275 | PLN02664, PLN02664, enoyl-CoA hydratase/delta3,5-d | 8e-11 | |
| PRK05617 | 342 | PRK05617, PRK05617, 3-hydroxyisobutyryl-CoA hydrol | 9e-11 | |
| PRK07938 | 249 | PRK07938, PRK07938, enoyl-CoA hydratase; Provision | 1e-10 | |
| PLN02988 | 381 | PLN02988, PLN02988, 3-hydroxyisobutyryl-CoA hydrol | 2e-10 | |
| PRK11154 | 708 | PRK11154, fadJ, multifunctional fatty acid oxidati | 9e-09 | |
| PLN02874 | 379 | PLN02874, PLN02874, 3-hydroxyisobutyryl-CoA hydrol | 3e-08 | |
| PRK07112 | 255 | PRK07112, PRK07112, polyketide biosynthesis enoyl- | 4e-08 | |
| TIGR02437 | 714 | TIGR02437, FadB, fatty oxidation complex, alpha su | 6e-08 | |
| PLN02157 | 401 | PLN02157, PLN02157, 3-hydroxyisobutyryl-CoA hydrol | 7e-08 | |
| PRK09076 | 258 | PRK09076, PRK09076, enoyl-CoA hydratase; Provision | 3e-07 | |
| PRK11730 | 715 | PRK11730, fadB, multifunctional fatty acid oxidati | 9e-07 | |
| PLN02851 | 407 | PLN02851, PLN02851, 3-hydroxyisobutyryl-CoA hydrol | 1e-06 | |
| TIGR02440 | 699 | TIGR02440, FadJ, fatty oxidation complex, alpha su | 6e-05 |
| >gnl|CDD|178509 PLN02921, PLN02921, naphthoate synthase | Back alignment and domain information |
|---|
Score = 403 bits (1036), Expect = e-143
Identities = 166/216 (76%), Positives = 184/216 (85%)
Query: 6 DSARRRMTAVANHLVPVISSDSNSGFIGLNNASMNDSYHRIHGEVPSHDVVWRIACDESG 65
D+ARRR+ VANHLVP + S + + + DSY R+HG+V S VVWR D SG
Sbjct: 2 DAARRRLARVANHLVPSANPASMAAARSSSATAPPDSYRRVHGDVSSEPVVWRKVPDGSG 61
Query: 66 TEFTDIIYEKAVGEGIAKITINRPDRRNAFRPHTVKELIRAFNDARDDSSVGVIILTGKG 125
EFTDIIYEKAVGEGIAKITINRP+RRNAFRP TVKEL RAFNDARDDSSVGVIILTGKG
Sbjct: 62 KEFTDIIYEKAVGEGIAKITINRPERRNAFRPRTVKELQRAFNDARDDSSVGVIILTGKG 121
Query: 126 TEAFCSGGDQALRTRDGYADYENFGRLNVLDLQVQIRRLPKPVIAMVAGYAVGGGHVLHM 185
T+AFCSGGDQA+R +DGY ++ GRLNVLDLQ+QIRRLPKPVIAMVAGYAVGGGH+LHM
Sbjct: 122 TKAFCSGGDQAVRGKDGYVGPDDAGRLNVLDLQIQIRRLPKPVIAMVAGYAVGGGHILHM 181
Query: 186 VCDLTIAADNAIFGQTGPKVGSFDAGYGSSIMSRLV 221
VCDLTIAADNA+FGQTGPKVGSFDAGYGSSIM+RLV
Sbjct: 182 VCDLTIAADNAVFGQTGPKVGSFDAGYGSSIMARLV 217
|
Length = 327 |
| >gnl|CDD|180958 PRK07396, PRK07396, dihydroxynaphthoic acid synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223524 COG0447, MenB, Dihydroxynaphthoic acid synthase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|200143 TIGR01929, menB, naphthoate synthase (dihydroxynaphthoic acid synthetase) | Back alignment and domain information |
|---|
| >gnl|CDD|181386 PRK08321, PRK08321, naphthoate synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|132254 TIGR03210, badI, 2-ketocyclohexanecarboxyl-CoA hydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|201191 pfam00378, ECH, Enoyl-CoA hydratase/isomerase family | Back alignment and domain information |
|---|
| >gnl|CDD|119339 cd06558, crotonase-like, Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|223955 COG1024, CaiD, Enoyl-CoA hydratase/carnithine racemase [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|235852 PRK06688, PRK06688, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235664 PRK05995, PRK05995, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180270 PRK05809, PRK05809, 3-hydroxybutyryl-CoA dehydratase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|180591 PRK06494, PRK06494, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180295 PRK05862, PRK05862, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132244 TIGR03200, dearomat_oah, 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|235705 PRK06127, PRK06127, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181009 PRK07511, PRK07511, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236220 PRK08290, PRK08290, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180424 PRK06144, PRK06144, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236206 PRK08260, PRK08260, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181069 PRK07657, PRK07657, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180987 PRK07468, PRK07468, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236163 PRK08140, PRK08140, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236162 PRK08138, PRK08138, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236383 PRK09120, PRK09120, p-hydroxycinnamoyl CoA hydratase/lyase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|180472 PRK06210, PRK06210, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181249 PRK08139, PRK08139, enoyl-CoA hydratase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|181723 PRK09245, PRK09245, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215480 PLN02888, PLN02888, enoyl-CoA hydratase | Back alignment and domain information |
|---|
| >gnl|CDD|236213 PRK08272, PRK08272, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|179599 PRK03580, PRK03580, carnitinyl-CoA dehydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235936 PRK07110, PRK07110, polyketide biosynthesis enoyl-CoA hydratase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|180298 PRK05870, PRK05870, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236205 PRK08259, PRK08259, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235733 PRK06190, PRK06190, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131333 TIGR02280, PaaB1, phenylacetate degradation probable enoyl-CoA hydratase paaB | Back alignment and domain information |
|---|
| >gnl|CDD|182026 PRK09674, PRK09674, enoyl-CoA hydratase-isomerase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|168278 PRK05864, PRK05864, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236115 PRK07854, PRK07854, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181325 PRK08252, PRK08252, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181329 PRK08258, PRK08258, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180335 PRK05980, PRK05980, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235714 PRK06142, PRK06142, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|168168 PRK05674, PRK05674, gamma-carboxygeranoyl-CoA hydratase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236109 PRK07827, PRK07827, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181122 PRK07799, PRK07799, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181070 PRK07658, PRK07658, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180910 PRK07260, PRK07260, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236908 PRK11423, PRK11423, methylmalonyl-CoA decarboxylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|168580 PRK06495, PRK06495, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181008 PRK07509, PRK07509, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178210 PLN02600, PLN02600, enoyl-CoA hydratase | Back alignment and domain information |
|---|
| >gnl|CDD|183548 PRK12478, PRK12478, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235661 PRK05981, PRK05981, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235991 PRK07327, PRK07327, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180423 PRK06143, PRK06143, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180625 PRK06563, PRK06563, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181254 PRK08150, PRK08150, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|168351 PRK06023, PRK06023, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235632 PRK05869, PRK05869, enoyl-CoA hydratase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236073 PRK07659, PRK07659, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|168377 PRK06072, PRK06072, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178269 PLN02664, PLN02664, enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA isomerase | Back alignment and domain information |
|---|
| >gnl|CDD|235533 PRK05617, PRK05617, 3-hydroxyisobutyryl-CoA hydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181174 PRK07938, PRK07938, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178568 PLN02988, PLN02988, 3-hydroxyisobutyryl-CoA hydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|236864 PRK11154, fadJ, multifunctional fatty acid oxidation complex subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|178462 PLN02874, PLN02874, 3-hydroxyisobutyryl-CoA hydrolase-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|235938 PRK07112, PRK07112, polyketide biosynthesis enoyl-CoA hydratase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|131490 TIGR02437, FadB, fatty oxidation complex, alpha subunit FadB | Back alignment and domain information |
|---|
| >gnl|CDD|177817 PLN02157, PLN02157, 3-hydroxyisobutyryl-CoA hydrolase-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|236373 PRK09076, PRK09076, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183293 PRK11730, fadB, multifunctional fatty acid oxidation complex subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|178443 PLN02851, PLN02851, 3-hydroxyisobutyryl-CoA hydrolase-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|131493 TIGR02440, FadJ, fatty oxidation complex, alpha subunit FadJ | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 240 | |||
| PLN02921 | 327 | naphthoate synthase | 100.0 | |
| PRK07396 | 273 | dihydroxynaphthoic acid synthetase; Validated | 100.0 | |
| TIGR03210 | 256 | badI 2-ketocyclohexanecarboxyl-CoA hydrolase. Memb | 100.0 | |
| TIGR01929 | 259 | menB naphthoate synthase (dihydroxynaphthoic acid | 100.0 | |
| PRK09120 | 275 | p-hydroxycinnamoyl CoA hydratase/lyase; Validated | 100.0 | |
| PRK09076 | 258 | enoyl-CoA hydratase; Provisional | 100.0 | |
| COG1024 | 257 | CaiD Enoyl-CoA hydratase/carnithine racemase [Lipi | 100.0 | |
| PRK05809 | 260 | 3-hydroxybutyryl-CoA dehydratase; Validated | 100.0 | |
| KOG1680 | 290 | consensus Enoyl-CoA hydratase [Lipid transport and | 100.0 | |
| PRK05980 | 260 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK07657 | 260 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK05862 | 257 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK06143 | 256 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK06142 | 272 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK06563 | 255 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK05870 | 249 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK06190 | 258 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK06144 | 262 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK09674 | 255 | enoyl-CoA hydratase-isomerase; Provisional | 100.0 | |
| PRK07327 | 268 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK08150 | 255 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK07799 | 263 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PLN02664 | 275 | enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA | 100.0 | |
| PRK07658 | 257 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK07659 | 260 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PLN02600 | 251 | enoyl-CoA hydratase | 100.0 | |
| PRK08140 | 262 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK05995 | 262 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK06494 | 259 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK08260 | 296 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK08138 | 261 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK06127 | 269 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK05674 | 265 | gamma-carboxygeranoyl-CoA hydratase; Validated | 100.0 | |
| PRK06023 | 251 | enoyl-CoA hydratase; Provisional | 100.0 | |
| TIGR02280 | 256 | PaaB1 phenylacetate degradation probable enoyl-CoA | 100.0 | |
| PRK09245 | 266 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK07511 | 260 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK08321 | 302 | naphthoate synthase; Validated | 100.0 | |
| PRK05981 | 266 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK07260 | 255 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK07509 | 262 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK06210 | 272 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK05864 | 276 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK05869 | 222 | enoyl-CoA hydratase; Validated | 100.0 | |
| PRK08139 | 266 | enoyl-CoA hydratase; Validated | 100.0 | |
| PRK06688 | 259 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK11423 | 261 | methylmalonyl-CoA decarboxylase; Provisional | 100.0 | |
| PLN02888 | 265 | enoyl-CoA hydratase | 100.0 | |
| PRK07468 | 262 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK08252 | 254 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK07854 | 243 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK03580 | 261 | carnitinyl-CoA dehydratase; Provisional | 100.0 | |
| PRK07110 | 249 | polyketide biosynthesis enoyl-CoA hydratase; Valid | 100.0 | |
| PRK08258 | 277 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK06072 | 248 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK08259 | 254 | enoyl-CoA hydratase; Provisional | 100.0 | |
| TIGR03189 | 251 | dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hy | 100.0 | |
| PLN02157 | 401 | 3-hydroxyisobutyryl-CoA hydrolase-like protein | 100.0 | |
| PRK07827 | 260 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PLN02851 | 407 | 3-hydroxyisobutyryl-CoA hydrolase-like protein | 100.0 | |
| PRK06495 | 257 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK08788 | 287 | enoyl-CoA hydratase; Validated | 100.0 | |
| PRK08290 | 288 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PLN02874 | 379 | 3-hydroxyisobutyryl-CoA hydrolase-like protein | 100.0 | |
| PF00378 | 245 | ECH: Enoyl-CoA hydratase/isomerase family; InterPr | 100.0 | |
| PRK05617 | 342 | 3-hydroxyisobutyryl-CoA hydrolase; Provisional | 100.0 | |
| PRK07112 | 255 | polyketide biosynthesis enoyl-CoA hydratase; Valid | 100.0 | |
| PLN03214 | 278 | probable enoyl-CoA hydratase/isomerase; Provisiona | 100.0 | |
| PRK07938 | 249 | enoyl-CoA hydratase; Provisional | 100.0 | |
| TIGR03200 | 360 | dearomat_oah 6-oxocyclohex-1-ene-1-carbonyl-CoA hy | 100.0 | |
| PLN02988 | 381 | 3-hydroxyisobutyryl-CoA hydrolase | 100.0 | |
| PRK08272 | 302 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK12478 | 298 | enoyl-CoA hydratase; Provisional | 100.0 | |
| COG0447 | 282 | MenB Dihydroxynaphthoic acid synthase [Coenzyme me | 100.0 | |
| PLN02267 | 239 | enoyl-CoA hydratase/isomerase family protein | 100.0 | |
| PRK06213 | 229 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK11730 | 715 | fadB multifunctional fatty acid oxidation complex | 100.0 | |
| KOG1679 | 291 | consensus Enoyl-CoA hydratase [Lipid transport and | 100.0 | |
| TIGR02437 | 714 | FadB fatty oxidation complex, alpha subunit FadB. | 100.0 | |
| PRK11154 | 708 | fadJ multifunctional fatty acid oxidation complex | 100.0 | |
| cd06558 | 195 | crotonase-like Crotonase/Enoyl-Coenzyme A (CoA) hy | 100.0 | |
| TIGR02441 | 737 | fa_ox_alpha_mit fatty acid oxidation complex, alph | 100.0 | |
| TIGR03222 | 546 | benzo_boxC benzoyl-CoA-dihydrodiol lyase. In the p | 100.0 | |
| TIGR02440 | 699 | FadJ fatty oxidation complex, alpha subunit FadJ. | 100.0 | |
| PRK08184 | 550 | benzoyl-CoA-dihydrodiol lyase; Provisional | 100.0 | |
| TIGR03222 | 546 | benzo_boxC benzoyl-CoA-dihydrodiol lyase. In the p | 100.0 | |
| KOG1681 | 292 | consensus Enoyl-CoA isomerase [Lipid transport and | 100.0 | |
| PRK08184 | 550 | benzoyl-CoA-dihydrodiol lyase; Provisional | 100.0 | |
| KOG0016 | 266 | consensus Enoyl-CoA hydratase/isomerase [Lipid tra | 100.0 | |
| KOG1684 | 401 | consensus Enoyl-CoA hydratase [Lipid transport and | 99.97 | |
| KOG1682 | 287 | consensus Enoyl-CoA isomerase [Lipid transport and | 99.96 | |
| cd07014 | 177 | S49_SppA Signal peptide peptidase A. Signal peptid | 99.69 | |
| cd07020 | 187 | Clp_protease_NfeD_1 Nodulation formation efficienc | 99.64 | |
| cd07019 | 211 | S49_SppA_1 Signal peptide peptidase A (SppA), a se | 99.52 | |
| cd07022 | 214 | S49_Sppa_36K_type Signal peptide peptidase A (SppA | 99.37 | |
| cd07023 | 208 | S49_Sppa_N_C Signal peptide peptidase A (SppA), a | 99.35 | |
| cd00394 | 161 | Clp_protease_like Caseinolytic protease (ClpP) is | 99.23 | |
| cd07016 | 160 | S14_ClpP_1 Caseinolytic protease (ClpP) is an ATP- | 99.14 | |
| TIGR00706 | 207 | SppA_dom signal peptide peptidase SppA, 36K type. | 99.13 | |
| TIGR00705 | 584 | SppA_67K signal peptide peptidase SppA, 67K type. | 99.08 | |
| cd07018 | 222 | S49_SppA_67K_type Signal peptide peptidase A (SppA | 98.96 | |
| cd07021 | 178 | Clp_protease_NfeD_like Nodulation formation effici | 98.88 | |
| cd07015 | 172 | Clp_protease_NfeD Nodulation formation efficiency | 97.85 | |
| KOG1683 | 380 | consensus Hydroxyacyl-CoA dehydrogenase/enoyl-CoA | 97.82 | |
| PRK10949 | 618 | protease 4; Provisional | 97.64 | |
| PF01972 | 285 | SDH_sah: Serine dehydrogenase proteinase; InterPro | 97.59 | |
| PRK07189 | 301 | malonate decarboxylase subunit beta; Reviewed | 97.55 | |
| cd07013 | 162 | S14_ClpP Caseinolytic protease (ClpP) is an ATP-de | 97.55 | |
| TIGR03133 | 274 | malonate_beta malonate decarboxylase, beta subunit | 97.48 | |
| CHL00198 | 322 | accA acetyl-CoA carboxylase carboxyltransferase al | 97.12 | |
| PF00574 | 182 | CLP_protease: Clp protease; InterPro: IPR001907 In | 97.12 | |
| PRK12319 | 256 | acetyl-CoA carboxylase subunit alpha; Provisional | 97.07 | |
| COG0616 | 317 | SppA Periplasmic serine proteases (ClpP class) [Po | 97.01 | |
| PRK00277 | 200 | clpP ATP-dependent Clp protease proteolytic subuni | 96.96 | |
| cd07017 | 171 | S14_ClpP_2 Caseinolytic protease (ClpP) is an ATP- | 96.89 | |
| PRK11778 | 330 | putative inner membrane peptidase; Provisional | 96.84 | |
| PRK12553 | 207 | ATP-dependent Clp protease proteolytic subunit; Re | 96.76 | |
| TIGR00705 | 584 | SppA_67K signal peptide peptidase SppA, 67K type. | 96.68 | |
| TIGR00513 | 316 | accA acetyl-CoA carboxylase, carboxyl transferase, | 96.67 | |
| PF01039 | 493 | Carboxyl_trans: Carboxyl transferase domain; Inter | 96.66 | |
| PLN03229 | 762 | acetyl-coenzyme A carboxylase carboxyl transferase | 96.62 | |
| PLN03230 | 431 | acetyl-coenzyme A carboxylase carboxyl transferase | 96.6 | |
| CHL00174 | 296 | accD acetyl-CoA carboxylase beta subunit; Reviewed | 96.52 | |
| PRK05724 | 319 | acetyl-CoA carboxylase carboxyltransferase subunit | 96.47 | |
| TIGR00515 | 285 | accD acetyl-CoA carboxylase, carboxyl transferase, | 96.45 | |
| PRK05654 | 292 | acetyl-CoA carboxylase subunit beta; Validated | 96.28 | |
| PRK14512 | 197 | ATP-dependent Clp protease proteolytic subunit; Pr | 96.25 | |
| PRK10949 | 618 | protease 4; Provisional | 95.84 | |
| PLN02820 | 569 | 3-methylcrotonyl-CoA carboxylase, beta chain | 95.72 | |
| TIGR01117 | 512 | mmdA methylmalonyl-CoA decarboxylase alpha subunit | 95.53 | |
| CHL00028 | 200 | clpP ATP-dependent Clp protease proteolytic subuni | 95.48 | |
| TIGR01117 | 512 | mmdA methylmalonyl-CoA decarboxylase alpha subunit | 95.48 | |
| TIGR00493 | 191 | clpP ATP-dependent Clp protease, proteolytic subun | 95.25 | |
| COG1030 | 436 | NfeD Membrane-bound serine protease (ClpP class) [ | 95.07 | |
| PF01343 | 154 | Peptidase_S49: Peptidase family S49 peptidase clas | 94.88 | |
| COG4799 | 526 | Acetyl-CoA carboxylase, carboxyltransferase compon | 94.77 | |
| PRK12551 | 196 | ATP-dependent Clp protease proteolytic subunit; Re | 94.32 | |
| PRK14514 | 221 | ATP-dependent Clp protease proteolytic subunit; Pr | 93.77 | |
| PRK14513 | 201 | ATP-dependent Clp protease proteolytic subunit; Pr | 93.7 | |
| COG0777 | 294 | AccD Acetyl-CoA carboxylase beta subunit [Lipid me | 93.51 | |
| TIGR03134 | 238 | malonate_gamma malonate decarboxylase, gamma subun | 93.1 | |
| PF01039 | 493 | Carboxyl_trans: Carboxyl transferase domain; Inter | 89.62 | |
| COG0074 | 293 | SucD Succinyl-CoA synthetase, alpha subunit [Energ | 86.99 | |
| PLN02820 | 569 | 3-methylcrotonyl-CoA carboxylase, beta chain | 86.49 | |
| COG0740 | 200 | ClpP Protease subunit of ATP-dependent Clp proteas | 84.34 | |
| PF02601 | 319 | Exonuc_VII_L: Exonuclease VII, large subunit; Inte | 81.12 | |
| PRK12552 | 222 | ATP-dependent Clp protease-like protein; Reviewed | 80.61 |
| >PLN02921 naphthoate synthase | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.3e-53 Score=377.84 Aligned_cols=234 Identities=72% Similarity=1.104 Sum_probs=204.7
Q ss_pred hHHHhHhHHHhhhccccCccCCCCCCccccCCCcCCCccccccCCcccCcccceeeccCCCCcceeEEEEEEeCCCEEEE
Q 026342 5 IDSARRRMTAVANHLVPVISSDSNSGFIGLNNASMNDSYHRIHGEVPSHDVVWRIACDESGTEFTDIIYEKAVGEGIAKI 84 (240)
Q Consensus 5 ~~~~~~r~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~v~~I 84 (240)
|+++.||++++++|+.|++..++..++...+..+.+++|++.|+.|+.+|..|..++.+++.+|++|.++++.+++|++|
T Consensus 1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~Va~I 80 (327)
T PLN02921 1 MDAARRRLARVANHLVPSANPASMAAARSSSATAPPDSYRRVHGDVSSEPVVWRKVPDGSGKEFTDIIYEKAVGEGIAKI 80 (327)
T ss_pred CchhhhHHHHHhcccCcccccccccccccccccCCCCchhhhccccCCCCccccccccCCccCCceEEEEEecCCCEEEE
Confidence 68899999999999998777666666545556688999999999999999999999888888999999987435899999
Q ss_pred EEcCCCCCCCCCHHHHHHHHHHHHHhhhCCCeeEEEEeeCCCCCcccCCCccccccCCccchhhhhhhhHHHHHHHHHcC
Q 026342 85 TINRPDRRNAFRPHTVKELIRAFNDARDDSSVGVIILTGKGTEAFCSGGDQALRTRDGYADYENFGRLNVLDLQVQIRRL 164 (240)
Q Consensus 85 tlnrp~~~Nal~~~~~~~L~~~l~~~~~d~~v~vvVltg~g~~~FcaG~Dl~~~~~~~~~~~~~~~~~~~~~l~~~i~~~ 164 (240)
+||||+++|+||.+|+.+|.++|+.++.|+++++|||+|.|+++||+|+|++++.................+++.+|.++
T Consensus 81 tLnrP~~~Nal~~~~~~eL~~al~~~~~d~~vrvVVLtg~G~k~FcaG~Dl~~~~~~~~~~~~~~~~~~~~~l~~~l~~~ 160 (327)
T PLN02921 81 TINRPERRNAFRPRTVKELQRAFNDARDDSSVGVIILTGKGTKAFCSGGDQAVRGKDGYVGPDDAGRLNVLDLQIQIRRL 160 (327)
T ss_pred EECCCCCCCCCCHHHHHHHHHHHHHHhhCCCceEEEEecCCCCceecCcChhhhhcccccchhHHHHHHHHHHHHHHHhC
Confidence 99999999999999999999999999999999999999999679999999987643211111111111234567789999
Q ss_pred CCcEEEEECchhchhhHHHhhhcCEEEEeCCcEEecccccccccCCCchHHHHHhhcCHHHHHHHHhcCCcccc
Q 026342 165 PKPVIAMVAGYAVGGGHVLHMVCDLTIAADNAIFGQTGPKVGSFDAGYGSSIMSRLVSTVQQCLWWGLKKHVKC 238 (240)
Q Consensus 165 ~kP~IAav~G~a~GgG~~lal~~D~rias~~a~f~~pe~~~Gl~p~~g~~~~l~rlvG~~~a~ellltG~~i~A 238 (240)
||||||+|||+|+|||++|+++||+|||+++++|++||+++|++|+++++++|++++|.++|++|+++|+.|+|
T Consensus 161 ~kPvIAaVnG~a~GGG~~LalacD~riA~~~A~f~~pe~~~Gl~p~~gg~~~L~rliG~~~A~ellltG~~~~A 234 (327)
T PLN02921 161 PKPVIAMVAGYAVGGGHILHMVCDLTIAADNAVFGQTGPKVGSFDAGYGSSIMARLVGQKKAREMWFLARFYTA 234 (327)
T ss_pred CCCEEEEECCEEecHHHHHHHhCCEEEEeCCCEEeCcccccCCCCCccHHHHHHHHhCHHHHHHHHHcCCcCCH
Confidence 99999999999999999999999999999999999999999999999899999999999999999999999987
|
|
| >PRK07396 dihydroxynaphthoic acid synthetase; Validated | Back alignment and domain information |
|---|
| >TIGR03210 badI 2-ketocyclohexanecarboxyl-CoA hydrolase | Back alignment and domain information |
|---|
| >TIGR01929 menB naphthoate synthase (dihydroxynaphthoic acid synthetase) | Back alignment and domain information |
|---|
| >PRK09120 p-hydroxycinnamoyl CoA hydratase/lyase; Validated | Back alignment and domain information |
|---|
| >PRK09076 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >COG1024 CaiD Enoyl-CoA hydratase/carnithine racemase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK05809 3-hydroxybutyryl-CoA dehydratase; Validated | Back alignment and domain information |
|---|
| >KOG1680 consensus Enoyl-CoA hydratase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05980 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07657 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK05862 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06143 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06142 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06563 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK05870 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06190 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06144 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK09674 enoyl-CoA hydratase-isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK07327 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK08150 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07799 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PLN02664 enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA isomerase | Back alignment and domain information |
|---|
| >PRK07658 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07659 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PLN02600 enoyl-CoA hydratase | Back alignment and domain information |
|---|
| >PRK08140 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK05995 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06494 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK08260 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK08138 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06127 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK05674 gamma-carboxygeranoyl-CoA hydratase; Validated | Back alignment and domain information |
|---|
| >PRK06023 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >TIGR02280 PaaB1 phenylacetate degradation probable enoyl-CoA hydratase paaB | Back alignment and domain information |
|---|
| >PRK09245 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07511 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK08321 naphthoate synthase; Validated | Back alignment and domain information |
|---|
| >PRK05981 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07260 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07509 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06210 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK05864 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK05869 enoyl-CoA hydratase; Validated | Back alignment and domain information |
|---|
| >PRK08139 enoyl-CoA hydratase; Validated | Back alignment and domain information |
|---|
| >PRK06688 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK11423 methylmalonyl-CoA decarboxylase; Provisional | Back alignment and domain information |
|---|
| >PLN02888 enoyl-CoA hydratase | Back alignment and domain information |
|---|
| >PRK07468 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK08252 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07854 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK03580 carnitinyl-CoA dehydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07110 polyketide biosynthesis enoyl-CoA hydratase; Validated | Back alignment and domain information |
|---|
| >PRK08258 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06072 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK08259 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >TIGR03189 dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hydratase | Back alignment and domain information |
|---|
| >PLN02157 3-hydroxyisobutyryl-CoA hydrolase-like protein | Back alignment and domain information |
|---|
| >PRK07827 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PLN02851 3-hydroxyisobutyryl-CoA hydrolase-like protein | Back alignment and domain information |
|---|
| >PRK06495 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK08788 enoyl-CoA hydratase; Validated | Back alignment and domain information |
|---|
| >PRK08290 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PLN02874 3-hydroxyisobutyryl-CoA hydrolase-like protein | Back alignment and domain information |
|---|
| >PF00378 ECH: Enoyl-CoA hydratase/isomerase family; InterPro: IPR001753 The crotonase superfamily is comprised of mechanistically diverse proteins that share a conserved trimeric quaternary structure (sometimes a hexamer consisting of a dimer of trimers), the core of which consists of 4 turns of a (beta/beta/alpha)n superhelix | Back alignment and domain information |
|---|
| >PRK05617 3-hydroxyisobutyryl-CoA hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK07112 polyketide biosynthesis enoyl-CoA hydratase; Validated | Back alignment and domain information |
|---|
| >PLN03214 probable enoyl-CoA hydratase/isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK07938 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >TIGR03200 dearomat_oah 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase | Back alignment and domain information |
|---|
| >PLN02988 3-hydroxyisobutyryl-CoA hydrolase | Back alignment and domain information |
|---|
| >PRK08272 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK12478 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >COG0447 MenB Dihydroxynaphthoic acid synthase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PLN02267 enoyl-CoA hydratase/isomerase family protein | Back alignment and domain information |
|---|
| >PRK06213 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >KOG1679 consensus Enoyl-CoA hydratase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02437 FadB fatty oxidation complex, alpha subunit FadB | Back alignment and domain information |
|---|
| >PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >cd06558 crotonase-like Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily | Back alignment and domain information |
|---|
| >TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial | Back alignment and domain information |
|---|
| >TIGR03222 benzo_boxC benzoyl-CoA-dihydrodiol lyase | Back alignment and domain information |
|---|
| >TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ | Back alignment and domain information |
|---|
| >PRK08184 benzoyl-CoA-dihydrodiol lyase; Provisional | Back alignment and domain information |
|---|
| >TIGR03222 benzo_boxC benzoyl-CoA-dihydrodiol lyase | Back alignment and domain information |
|---|
| >KOG1681 consensus Enoyl-CoA isomerase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08184 benzoyl-CoA-dihydrodiol lyase; Provisional | Back alignment and domain information |
|---|
| >KOG0016 consensus Enoyl-CoA hydratase/isomerase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1684 consensus Enoyl-CoA hydratase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1682 consensus Enoyl-CoA isomerase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >cd07014 S49_SppA Signal peptide peptidase A | Back alignment and domain information |
|---|
| >cd07020 Clp_protease_NfeD_1 Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease | Back alignment and domain information |
|---|
| >cd07019 S49_SppA_1 Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad | Back alignment and domain information |
|---|
| >cd07022 S49_Sppa_36K_type Signal peptide peptidase A (SppA) 36K type, a serine protease, has catalytic Ser-Lys dyad | Back alignment and domain information |
|---|
| >cd07023 S49_Sppa_N_C Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad | Back alignment and domain information |
|---|
| >cd00394 Clp_protease_like Caseinolytic protease (ClpP) is an ATP-dependent protease | Back alignment and domain information |
|---|
| >cd07016 S14_ClpP_1 Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease | Back alignment and domain information |
|---|
| >TIGR00706 SppA_dom signal peptide peptidase SppA, 36K type | Back alignment and domain information |
|---|
| >TIGR00705 SppA_67K signal peptide peptidase SppA, 67K type | Back alignment and domain information |
|---|
| >cd07018 S49_SppA_67K_type Signal peptide peptidase A (SppA) 67K type, a serine protease, has catalytic Ser-Lys dyad | Back alignment and domain information |
|---|
| >cd07021 Clp_protease_NfeD_like Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease | Back alignment and domain information |
|---|
| >cd07015 Clp_protease_NfeD Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease | Back alignment and domain information |
|---|
| >KOG1683 consensus Hydroxyacyl-CoA dehydrogenase/enoyl-CoA hydratase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10949 protease 4; Provisional | Back alignment and domain information |
|---|
| >PF01972 SDH_sah: Serine dehydrogenase proteinase; InterPro: IPR002825 This family of archaebacterial proteins, formerly known as DUF114, has been found to be a serine dehydrogenase proteinase distantly related to ClpP proteinases that belong to the serine proteinase superfamily | Back alignment and domain information |
|---|
| >PRK07189 malonate decarboxylase subunit beta; Reviewed | Back alignment and domain information |
|---|
| >cd07013 S14_ClpP Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease | Back alignment and domain information |
|---|
| >TIGR03133 malonate_beta malonate decarboxylase, beta subunit | Back alignment and domain information |
|---|
| >CHL00198 accA acetyl-CoA carboxylase carboxyltransferase alpha subunit; Provisional | Back alignment and domain information |
|---|
| >PF00574 CLP_protease: Clp protease; InterPro: IPR001907 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PRK12319 acetyl-CoA carboxylase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >COG0616 SppA Periplasmic serine proteases (ClpP class) [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK00277 clpP ATP-dependent Clp protease proteolytic subunit; Reviewed | Back alignment and domain information |
|---|
| >cd07017 S14_ClpP_2 Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease | Back alignment and domain information |
|---|
| >PRK11778 putative inner membrane peptidase; Provisional | Back alignment and domain information |
|---|
| >PRK12553 ATP-dependent Clp protease proteolytic subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR00705 SppA_67K signal peptide peptidase SppA, 67K type | Back alignment and domain information |
|---|
| >TIGR00513 accA acetyl-CoA carboxylase, carboxyl transferase, alpha subunit | Back alignment and domain information |
|---|
| >PF01039 Carboxyl_trans: Carboxyl transferase domain; InterPro: IPR000022 Members in this domain include biotin dependent carboxylases [, ] | Back alignment and domain information |
|---|
| >PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PLN03230 acetyl-coenzyme A carboxylase carboxyl transferase; Provisional | Back alignment and domain information |
|---|
| >CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK05724 acetyl-CoA carboxylase carboxyltransferase subunit alpha; Validated | Back alignment and domain information |
|---|
| >TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit | Back alignment and domain information |
|---|
| >PRK05654 acetyl-CoA carboxylase subunit beta; Validated | Back alignment and domain information |
|---|
| >PRK14512 ATP-dependent Clp protease proteolytic subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10949 protease 4; Provisional | Back alignment and domain information |
|---|
| >PLN02820 3-methylcrotonyl-CoA carboxylase, beta chain | Back alignment and domain information |
|---|
| >TIGR01117 mmdA methylmalonyl-CoA decarboxylase alpha subunit | Back alignment and domain information |
|---|
| >CHL00028 clpP ATP-dependent Clp protease proteolytic subunit | Back alignment and domain information |
|---|
| >TIGR01117 mmdA methylmalonyl-CoA decarboxylase alpha subunit | Back alignment and domain information |
|---|
| >TIGR00493 clpP ATP-dependent Clp protease, proteolytic subunit ClpP | Back alignment and domain information |
|---|
| >COG1030 NfeD Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF01343 Peptidase_S49: Peptidase family S49 peptidase classification | Back alignment and domain information |
|---|
| >COG4799 Acetyl-CoA carboxylase, carboxyltransferase component (subunits alpha and beta) [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK12551 ATP-dependent Clp protease proteolytic subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK14514 ATP-dependent Clp protease proteolytic subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14513 ATP-dependent Clp protease proteolytic subunit; Provisional | Back alignment and domain information |
|---|
| >COG0777 AccD Acetyl-CoA carboxylase beta subunit [Lipid metabolism] | Back alignment and domain information |
|---|
| >TIGR03134 malonate_gamma malonate decarboxylase, gamma subunit | Back alignment and domain information |
|---|
| >PF01039 Carboxyl_trans: Carboxyl transferase domain; InterPro: IPR000022 Members in this domain include biotin dependent carboxylases [, ] | Back alignment and domain information |
|---|
| >COG0074 SucD Succinyl-CoA synthetase, alpha subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PLN02820 3-methylcrotonyl-CoA carboxylase, beta chain | Back alignment and domain information |
|---|
| >COG0740 ClpP Protease subunit of ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF02601 Exonuc_VII_L: Exonuclease VII, large subunit; InterPro: IPR020579 Exonuclease VII 3 | Back alignment and domain information |
|---|
| >PRK12552 ATP-dependent Clp protease-like protein; Reviewed | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 240 | ||||
| 2iex_A | 272 | Crystal Structure Of Dihydroxynapthoic Acid Synthet | 1e-57 | ||
| 3t88_A | 289 | Crystal Structure Of Escherichia Coli Menb In Compl | 3e-56 | ||
| 4els_A | 285 | Structure Of E. Coli. 1,4-Dihydroxy-2- Naphthoyl Co | 3e-56 | ||
| 2uzf_A | 273 | Crystal Structure Of Staphylococcus Aureus 1,4-Dihy | 4e-54 | ||
| 4eml_A | 275 | Synechocystis Sp. Pcc 6803 1,4-Dihydroxy-2-Naphthoy | 1e-53 | ||
| 3h02_A | 288 | 2.15 Angstrom Resolution Crystal Structure Of Napht | 2e-53 | ||
| 1rjm_A | 339 | Crystal Structure Of Menb (rv0548c) From Mycobacter | 3e-38 | ||
| 1q51_A | 314 | Crystal Structure Of Mycobacterium Tuberculosis Men | 3e-38 | ||
| 3t8a_A | 334 | Crystal Structure Of Mycobacterium Tuberculosis Men | 4e-38 | ||
| 1dub_A | 261 | 2-Enoyl-Coa Hydratase, Data Collected At 100 K, Ph | 1e-16 | ||
| 1ey3_A | 258 | Structure Of Enoyl-Coa Hydratase Complexed With The | 4e-16 | ||
| 3h81_A | 278 | Crystal Structure Of Enoyl-Coa Hydratase From Mycob | 4e-16 | ||
| 3q0j_A | 258 | Crystal Structure Of The Mycobacterium Tuberculosis | 4e-16 | ||
| 1mj3_A | 260 | Crystal Structure Analysis Of Rat Enoyl-Coa Hydrata | 4e-16 | ||
| 3pzk_A | 257 | Crystal Structure Of The Mycobacterium Tuberculosis | 4e-16 | ||
| 2vsu_F | 276 | A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase | 1e-15 | ||
| 2vss_F | 276 | Wild-Type Hydroxycinnamoyl-Coa Hydratase Lyase In C | 2e-15 | ||
| 3moy_A | 263 | Crystal Structure Of Probable Enoyl-Coa Hydratase F | 2e-15 | ||
| 2vsu_C | 275 | A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase | 3e-15 | ||
| 2vsu_A | 276 | A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase | 3e-15 | ||
| 2vsu_E | 276 | A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase | 3e-15 | ||
| 2hw5_A | 286 | The Crystal Structure Of Human Enoyl-Coenzyme A (Co | 4e-15 | ||
| 2j5i_A | 276 | Crystal Structure Of Hydroxycinnamoyl-Coa Hydratase | 4e-15 | ||
| 2j5i_B | 276 | Crystal Structure Of Hydroxycinnamoyl-Coa Hydratase | 4e-15 | ||
| 2j5i_I | 276 | Crystal Structure Of Hydroxycinnamoyl-Coa Hydratase | 4e-15 | ||
| 3myb_A | 286 | Crystal Structure Of Enoyl-Coa Hydratase Mycobacter | 4e-15 | ||
| 2vss_E | 276 | Wild-Type Hydroxycinnamoyl-Coa Hydratase Lyase In C | 5e-15 | ||
| 1uiy_A | 253 | Crystal Structure Of Enoyl-Coa Hydratase From Therm | 9e-15 | ||
| 3p5m_A | 255 | Crystal Structure Of An Enoyl-Coa HydrataseISOMERAS | 3e-14 | ||
| 3he2_A | 264 | Crystal Structure Of Enoyl-Coa Hydratase From Mycob | 3e-14 | ||
| 3kqf_A | 265 | 1.8 Angstrom Resolution Crystal Structure Of Enoyl- | 2e-13 | ||
| 3tlf_A | 274 | Crystal Structure Of An Enoyl-Coa HydrataseISOMERAS | 3e-13 | ||
| 3t3w_A | 279 | Crystal Structure Of Probable Enoyl-Coa Hydratase F | 4e-13 | ||
| 1jxz_A | 269 | Structure Of The H90q Mutant Of 4-Chlorobenzoyl-Coe | 5e-13 | ||
| 3ome_A | 282 | Crystal Structure Of A Probable Enoyl-Coa Hydratase | 9e-13 | ||
| 3qka_A | 261 | Crystal Structure Of Enoyl-Coa Hydratase Echa5 From | 1e-12 | ||
| 1nzy_A | 269 | 4-Chlorobenzoyl Coenzyme A Dehalogenase From Pseudo | 2e-12 | ||
| 1nzy_B | 269 | 4-Chlorobenzoyl Coenzyme A Dehalogenase From Pseudo | 2e-12 | ||
| 3p85_A | 270 | Crystal Structure Enoyl-Coa Hydratase From Mycobact | 3e-12 | ||
| 3qyr_A | 253 | Crystal Structure Of Enoyl-Coa Hydratase Echa16_2 M | 3e-12 | ||
| 3r0o_A | 273 | Crystal Structure Of Carnitinyl-Coa Hydratase From | 4e-12 | ||
| 4f47_A | 278 | The Structure Of Enoyl-Coa Hydratase Echa19 From My | 4e-12 | ||
| 2pbp_A | 258 | Crystal Structure Of Enoyl-Coa Hydrates Subunit I ( | 8e-12 | ||
| 4fzw_A | 258 | Crystal Structure Of The Paaf-paag Hydratase-isomer | 2e-11 | ||
| 3r9t_A | 267 | Structure Of Echa1_1 From Mycobacterium Paratubercu | 2e-11 | ||
| 3sll_A | 290 | Crystal Structure Of A Probable Enoyl-Coa Hydratase | 2e-11 | ||
| 3r9s_A | 267 | Structure Of A Carnitinyl-Coa Dehydratase From Myco | 3e-11 | ||
| 2vx2_A | 287 | Crystal Structure Of Human Enoyl Coenzyme A Hydrata | 2e-10 | ||
| 4di1_A | 277 | Crystal Structure Of Enoyl-Coa Hydratase Echa17 Fro | 3e-10 | ||
| 3i47_A | 268 | Crystal Structure Of Putative Enoyl Coa HydrataseIS | 8e-10 | ||
| 3pe8_A | 256 | Crystal Structure Of Enoyl-Coa Hydratase From Mycob | 9e-10 | ||
| 3trr_A | 256 | Crystal Structure Of A Probable Enoyl-Coa Hydratase | 1e-09 | ||
| 3rsi_A | 265 | The Structure Of A Putative Enoyl-Coa HydrataseISOM | 1e-09 | ||
| 3qxi_A | 265 | Crystal Structure Of Enoyl-Coa Hydratase Echa1 From | 3e-09 | ||
| 2f6q_A | 280 | The Crystal Structure Of Human Peroxisomal Delta3, | 4e-09 | ||
| 3qre_A | 298 | Crystal Structure Of An Enoyl-Coa Hydratase Echa12_ | 5e-09 | ||
| 3qxz_A | 265 | Crystal Structure Of A Probable Enoyl-Coa Hydratase | 8e-09 | ||
| 2vre_A | 296 | Crystal Structure Of Human Peroxisomal Delta3,5, De | 1e-08 | ||
| 3oc7_A | 267 | Crystal Structure Of An Enoyl-Coa Hydratase From My | 3e-08 | ||
| 3hrx_A | 254 | Crystal Structure Of Phenylacetic Acid Degradation | 3e-08 | ||
| 3qmj_A | 256 | Crystal Structure Of Enoyl-Coa Hydratase Echa8_6 Fr | 7e-08 | ||
| 2ej5_A | 257 | Crystal Structure Of Gk2038 Protein (Enoyl-Coa Hydr | 1e-07 | ||
| 4fzw_C | 274 | Crystal Structure Of The Paaf-paag Hydratase-isomer | 1e-07 | ||
| 1dci_A | 275 | Dienoyl-Coa Isomerase Length = 275 | 1e-07 | ||
| 3r9q_A | 262 | Structure Of A Probable Enoyl-Coa HydrataseISOMERAS | 2e-07 | ||
| 3bpt_A | 363 | Crystal Structure Of Human Beta-Hydroxyisobutyryl-C | 2e-07 | ||
| 3lke_A | 263 | Crystal Structure Of Enoyl-Coa Hydratase From Bacil | 4e-07 | ||
| 3swx_A | 265 | Crystal Structure Of A Probable Enoyl-Coa Hydratase | 5e-07 | ||
| 2q35_A | 243 | Crystal Structure Of The Y82f Variant Of Ech2 Decar | 8e-07 | ||
| 2fbm_A | 291 | Acetyltransferase Domain Of Cdy1 Length = 291 | 9e-07 | ||
| 3fdu_A | 266 | Crystal Structure Of A Putative Enoyl-Coa Hydratase | 1e-06 | ||
| 2a7k_A | 250 | Carboxymethylproline Synthase (carb) From Pectobact | 1e-06 | ||
| 4j2u_A | 365 | Crystal Structure Of An Enoyl-coa Hydratase From Rh | 2e-06 | ||
| 2fw2_A | 260 | Catalytic Domain Of Cdy Length = 260 | 2e-06 | ||
| 1ef8_A | 261 | Crystal Structure Of Methylmalonyl Coa Decarboxylas | 3e-06 | ||
| 3qk8_A | 272 | Crystal Structure Of Enoyl-Coa Hydratase Echa15 Fro | 4e-06 | ||
| 2q2x_A | 243 | Crystal Structure Of The Ech2 Decarboxylase Domain | 4e-06 | ||
| 3l3s_A | 263 | Crystal Structure Of An Enoyl-Coa HydrotaseISOMERAS | 5e-06 | ||
| 3njb_A | 333 | Crystal Structure Of Enoyl-Coa Hydratase From Mycob | 7e-06 | ||
| 3rrv_A | 276 | Crystal Structure Of An Enoyl-Coa HydrataseISOMERAS | 2e-05 | ||
| 1hzd_A | 272 | Crystal Structure Of Human Auh Protein, An Rna-Bind | 2e-05 | ||
| 1wdk_A | 715 | Fatty Acid Beta-Oxidation Multienzyme Complex From | 4e-05 | ||
| 2ppy_A | 265 | Crystal Structure Of Enoyl-Coa Hydrates (Gk_1992) F | 4e-05 | ||
| 4hdt_A | 353 | Crystal Structure Of A Carnitinyl-Coa Dehydratase F | 7e-05 | ||
| 2pg8_A | 417 | Crystal Structure Of R254k Mutanat Of Dpgc With Bou | 8e-05 | ||
| 2np9_A | 440 | Crystal Structure Of A Dioxygenase In The Crotonase | 1e-04 | ||
| 3hin_A | 275 | Crystal Structure Of Putative Enoyl-Coa Hydratase F | 5e-04 |
| >pdb|2IEX|A Chain A, Crystal Structure Of Dihydroxynapthoic Acid Synthetase (Gk2873) From Geobacillus Kaustophilus Hta426 Length = 272 | Back alignment and structure |
|
| >pdb|3T88|A Chain A, Crystal Structure Of Escherichia Coli Menb In Complex With Substrate Analogue, Osb-Ncoa Length = 289 | Back alignment and structure |
| >pdb|4ELS|A Chain A, Structure Of E. Coli. 1,4-Dihydroxy-2- Naphthoyl Coenzyme A Synthases (Menb) In Complex With Bicarbonate Length = 285 | Back alignment and structure |
| >pdb|2UZF|A Chain A, Crystal Structure Of Staphylococcus Aureus 1,4-Dihydroxy-2- Naphthoyl Coa Synthase (Menb) In Complex With Acetoacetyl Coa Length = 273 | Back alignment and structure |
| >pdb|4EML|A Chain A, Synechocystis Sp. Pcc 6803 1,4-Dihydroxy-2-Naphthoyl-Coenzyme A Synthase (Menb) In Complex With Bicarbonate Length = 275 | Back alignment and structure |
| >pdb|3H02|A Chain A, 2.15 Angstrom Resolution Crystal Structure Of Naphthoate Synthase From Salmonella Typhimurium. Length = 288 | Back alignment and structure |
| >pdb|1RJM|A Chain A, Crystal Structure Of Menb (rv0548c) From Mycobacterium Tuberculosis Length = 339 | Back alignment and structure |
| >pdb|1Q51|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Menb In Complex With Acetoacetyl-Coenzyme A, A Key Enzyme In Vitamin K2 Biosynthesis Length = 314 | Back alignment and structure |
| >pdb|3T8A|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Menb In Complex With Substrate Analogue, Osb-Ncoa Length = 334 | Back alignment and structure |
| >pdb|1DUB|A Chain A, 2-Enoyl-Coa Hydratase, Data Collected At 100 K, Ph 6.5 Length = 261 | Back alignment and structure |
| >pdb|1EY3|A Chain A, Structure Of Enoyl-Coa Hydratase Complexed With The Substrate Dac-Coa Length = 258 | Back alignment and structure |
| >pdb|3H81|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase From Mycobacterium Tuberculosis Length = 278 | Back alignment and structure |
| >pdb|3Q0J|A Chain A, Crystal Structure Of The Mycobacterium Tuberculosis Crotonase In Complex With The Inhibitor Acetoacetylcoa Length = 258 | Back alignment and structure |
| >pdb|1MJ3|A Chain A, Crystal Structure Analysis Of Rat Enoyl-Coa Hydratase In Complex With Hexadienoyl-Coa Length = 260 | Back alignment and structure |
| >pdb|3PZK|A Chain A, Crystal Structure Of The Mycobacterium Tuberculosis Crotonase In Apo Form Length = 257 | Back alignment and structure |
| >pdb|2VSU|F Chain F, A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase-Lyase ( Hchl) With Acetyl-Coenzyme A And Vanillin Gives Insights Into Substrate Specificity And Mechanism Length = 276 | Back alignment and structure |
| >pdb|2VSS|F Chain F, Wild-Type Hydroxycinnamoyl-Coa Hydratase Lyase In Complex With Acetyl-Coa And Vanillin Length = 276 | Back alignment and structure |
| >pdb|3MOY|A Chain A, Crystal Structure Of Probable Enoyl-Coa Hydratase From Mycob Smegmatis Length = 263 | Back alignment and structure |
| >pdb|2VSU|C Chain C, A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase-Lyase ( Hchl) With Acetyl-Coenzyme A And Vanillin Gives Insights Into Substrate Specificity And Mechanism Length = 275 | Back alignment and structure |
| >pdb|2VSU|A Chain A, A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase-Lyase ( Hchl) With Acetyl-Coenzyme A And Vanillin Gives Insights Into Substrate Specificity And Mechanism. Length = 276 | Back alignment and structure |
| >pdb|2VSU|E Chain E, A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase-Lyase ( Hchl) With Acetyl-Coenzyme A And Vanillin Gives Insights Into Substrate Specificity And Mechanism Length = 276 | Back alignment and structure |
| >pdb|2HW5|A Chain A, The Crystal Structure Of Human Enoyl-Coenzyme A (Coa) Hydratase Short Chain 1, Echs1 Length = 286 | Back alignment and structure |
| >pdb|2J5I|A Chain A, Crystal Structure Of Hydroxycinnamoyl-Coa Hydratase-Lyase Length = 276 | Back alignment and structure |
| >pdb|2J5I|B Chain B, Crystal Structure Of Hydroxycinnamoyl-Coa Hydratase-Lyase Length = 276 | Back alignment and structure |
| >pdb|2J5I|I Chain I, Crystal Structure Of Hydroxycinnamoyl-Coa Hydratase-Lyase Length = 276 | Back alignment and structure |
| >pdb|3MYB|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase Mycobacterium Smegm Length = 286 | Back alignment and structure |
| >pdb|2VSS|E Chain E, Wild-Type Hydroxycinnamoyl-Coa Hydratase Lyase In Complex With Acetyl-Coa And Vanillin Length = 276 | Back alignment and structure |
| >pdb|1UIY|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase From Thermus Thermophilus Hb8 Length = 253 | Back alignment and structure |
| >pdb|3P5M|A Chain A, Crystal Structure Of An Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Avium Length = 255 | Back alignment and structure |
| >pdb|3HE2|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase From Mycobacterium Tuberculosis Length = 264 | Back alignment and structure |
| >pdb|3KQF|A Chain A, 1.8 Angstrom Resolution Crystal Structure Of Enoyl-Coa Hydratase From Bacillus Anthracis. Length = 265 | Back alignment and structure |
| >pdb|3TLF|A Chain A, Crystal Structure Of An Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Paratuberculosis Length = 274 | Back alignment and structure |
| >pdb|3T3W|A Chain A, Crystal Structure Of Probable Enoyl-Coa Hydratase From Mycobacterium Thermoresistibile Length = 279 | Back alignment and structure |
| >pdb|1JXZ|A Chain A, Structure Of The H90q Mutant Of 4-Chlorobenzoyl-Coenzyme A Dehalogenase Complexed With 4-Hydroxybenzoyl-Coenzyme A (Product) Length = 269 | Back alignment and structure |
| >pdb|3OME|A Chain A, Crystal Structure Of A Probable Enoyl-Coa Hydratase From Mycobacterium Smegmatis Length = 282 | Back alignment and structure |
| >pdb|3QKA|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase Echa5 From Mycobacterium Marinum Length = 261 | Back alignment and structure |
| >pdb|1NZY|A Chain A, 4-Chlorobenzoyl Coenzyme A Dehalogenase From Pseudomonas Sp. Strain Cbs-3 Length = 269 | Back alignment and structure |
| >pdb|1NZY|B Chain B, 4-Chlorobenzoyl Coenzyme A Dehalogenase From Pseudomonas Sp. Strain Cbs-3 Length = 269 | Back alignment and structure |
| >pdb|3P85|A Chain A, Crystal Structure Enoyl-Coa Hydratase From Mycobacterium Avium Length = 270 | Back alignment and structure |
| >pdb|3QYR|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase Echa16_2 Mycobacterium Paratuberculosis Atcc Baa-968 K-10 Length = 253 | Back alignment and structure |
| >pdb|3R0O|A Chain A, Crystal Structure Of Carnitinyl-Coa Hydratase From Mycobacterium Avium Length = 273 | Back alignment and structure |
| >pdb|4F47|A Chain A, The Structure Of Enoyl-Coa Hydratase Echa19 From Mycobacterium Marinum Length = 278 | Back alignment and structure |
| >pdb|2PBP|A Chain A, Crystal Structure Of Enoyl-Coa Hydrates Subunit I (Gk_2039) From Geobacillus Kaustophilus Hta426 Length = 258 | Back alignment and structure |
| >pdb|4FZW|A Chain A, Crystal Structure Of The Paaf-paag Hydratase-isomerase Complex From E.coli Length = 258 | Back alignment and structure |
| >pdb|3R9T|A Chain A, Structure Of Echa1_1 From Mycobacterium Paratuberculosis Atcc Baa-968 K-10 Length = 267 | Back alignment and structure |
| >pdb|3SLL|A Chain A, Crystal Structure Of A Probable Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Abscessus Length = 290 | Back alignment and structure |
| >pdb|3R9S|A Chain A, Structure Of A Carnitinyl-Coa Dehydratase From Mycobacterium Avium 104 Length = 267 | Back alignment and structure |
| >pdb|2VX2|A Chain A, Crystal Structure Of Human Enoyl Coenzyme A Hydratase Domain-Containing Protein 3 (Echdc3) Length = 287 | Back alignment and structure |
| >pdb|4DI1|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase Echa17 From Mycobacterium Marinum Length = 277 | Back alignment and structure |
| >pdb|3I47|A Chain A, Crystal Structure Of Putative Enoyl Coa HydrataseISOMERASE (Crotonase) From Legionella Pneumophila Subsp. Pneumophila Str. Philadelphia 1 Length = 268 | Back alignment and structure |
| >pdb|3PE8|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase From Mycobacterium Smegmatis Length = 256 | Back alignment and structure |
| >pdb|3TRR|A Chain A, Crystal Structure Of A Probable Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Abscessus Length = 256 | Back alignment and structure |
| >pdb|3RSI|A Chain A, The Structure Of A Putative Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Abscessus Atcc 19977 DSM 44196 Length = 265 | Back alignment and structure |
| >pdb|3QXI|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase Echa1 From Mycobacterium Marinum Length = 265 | Back alignment and structure |
| >pdb|2F6Q|A Chain A, The Crystal Structure Of Human Peroxisomal Delta3, Delta2 Enoyl Coa Isomerase (Peci) Length = 280 | Back alignment and structure |
| >pdb|3QRE|A Chain A, Crystal Structure Of An Enoyl-Coa Hydratase Echa12_1 From Mycobacterium Marinum Length = 298 | Back alignment and structure |
| >pdb|3QXZ|A Chain A, Crystal Structure Of A Probable Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Abscessus Length = 265 | Back alignment and structure |
| >pdb|2VRE|A Chain A, Crystal Structure Of Human Peroxisomal Delta3,5, Delta2,4-Dienoyl Coa Isomerase Length = 296 | Back alignment and structure |
| >pdb|3OC7|A Chain A, Crystal Structure Of An Enoyl-Coa Hydratase From Mycobacterium Avium Length = 267 | Back alignment and structure |
| >pdb|3HRX|A Chain A, Crystal Structure Of Phenylacetic Acid Degradation Protein Paag Length = 254 | Back alignment and structure |
| >pdb|3QMJ|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase Echa8_6 From Mycobacterium Marinum Length = 256 | Back alignment and structure |
| >pdb|2EJ5|A Chain A, Crystal Structure Of Gk2038 Protein (Enoyl-Coa Hydratase Subunit Ii) From Geobacillus Kaustophilus Length = 257 | Back alignment and structure |
| >pdb|4FZW|C Chain C, Crystal Structure Of The Paaf-paag Hydratase-isomerase Complex From E.coli Length = 274 | Back alignment and structure |
| >pdb|1DCI|A Chain A, Dienoyl-Coa Isomerase Length = 275 | Back alignment and structure |
| >pdb|3R9Q|A Chain A, Structure Of A Probable Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Abscessus Atcc 19977 DSM 44196 Length = 262 | Back alignment and structure |
| >pdb|3BPT|A Chain A, Crystal Structure Of Human Beta-Hydroxyisobutyryl-Coa Hydrolase In Complex With Quercetin Length = 363 | Back alignment and structure |
| >pdb|3LKE|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase From Bacillus Halodurans Length = 263 | Back alignment and structure |
| >pdb|3SWX|A Chain A, Crystal Structure Of A Probable Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Abscessus Length = 265 | Back alignment and structure |
| >pdb|2Q35|A Chain A, Crystal Structure Of The Y82f Variant Of Ech2 Decarboxylase Domain Of Curf From Lyngbya Majuscula Length = 243 | Back alignment and structure |
| >pdb|2FBM|A Chain A, Acetyltransferase Domain Of Cdy1 Length = 291 | Back alignment and structure |
| >pdb|3FDU|A Chain A, Crystal Structure Of A Putative Enoyl-Coa HydrataseISOMERASE FROM Acinetobacter Baumannii Length = 266 | Back alignment and structure |
| >pdb|2A7K|A Chain A, Carboxymethylproline Synthase (carb) From Pectobacterium Carotovora, Apo Enzyme Length = 250 | Back alignment and structure |
| >pdb|4J2U|A Chain A, Crystal Structure Of An Enoyl-coa Hydratase From Rhodobacter Sphaeroides 2.4.1 Length = 365 | Back alignment and structure |
| >pdb|2FW2|A Chain A, Catalytic Domain Of Cdy Length = 260 | Back alignment and structure |
| >pdb|1EF8|A Chain A, Crystal Structure Of Methylmalonyl Coa Decarboxylase Length = 261 | Back alignment and structure |
| >pdb|3QK8|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase Echa15 From Mycobacterium Marinum In Complex With An Unknown Ligand Length = 272 | Back alignment and structure |
| >pdb|2Q2X|A Chain A, Crystal Structure Of The Ech2 Decarboxylase Domain Of Curf From Lyngbya Majuscula Length = 243 | Back alignment and structure |
| >pdb|3L3S|A Chain A, Crystal Structure Of An Enoyl-Coa HydrotaseISOMERASE FAMILY Protein From Silicibacter Pomeroyi Length = 263 | Back alignment and structure |
| >pdb|3NJB|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase From Mycobacterium Smegmatis, Iodide Soak Length = 333 | Back alignment and structure |
| >pdb|3RRV|A Chain A, Crystal Structure Of An Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Paratuberculosis Length = 276 | Back alignment and structure |
| >pdb|1HZD|A Chain A, Crystal Structure Of Human Auh Protein, An Rna-Binding Homologue Of Enoyl-Coa Hydratase Length = 272 | Back alignment and structure |
| >pdb|1WDK|A Chain A, Fatty Acid Beta-Oxidation Multienzyme Complex From Pseudomonas Fragi, Form I (Native2) Length = 715 | Back alignment and structure |
| >pdb|2PPY|A Chain A, Crystal Structure Of Enoyl-Coa Hydrates (Gk_1992) From Geobacillus Kaustophilus Hta426 Length = 265 | Back alignment and structure |
| >pdb|4HDT|A Chain A, Crystal Structure Of A Carnitinyl-Coa Dehydratase From Mycobacterium Thermoresistibile Length = 353 | Back alignment and structure |
| >pdb|2PG8|A Chain A, Crystal Structure Of R254k Mutanat Of Dpgc With Bound Substrate Analog Length = 417 | Back alignment and structure |
| >pdb|2NP9|A Chain A, Crystal Structure Of A Dioxygenase In The Crotonase Superfamily Length = 440 | Back alignment and structure |
| >pdb|3HIN|A Chain A, Crystal Structure Of Putative Enoyl-Coa Hydratase From Rhodopseudomonas Palustris Cga009 Length = 275 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 240 | |||
| 2uzf_A | 273 | Naphthoate synthase; lyase, menaquinone biosynthes | 8e-92 | |
| 3t89_A | 289 | 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase | 5e-91 | |
| 4eml_A | 275 | Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coe | 1e-90 | |
| 3t8b_A | 334 | 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase | 9e-84 | |
| 3t3w_A | 279 | Probable enoyl-COA hydratase; ssgcid, structural g | 2e-72 | |
| 2j5i_A | 276 | P-hydroxycinnamoyl COA hydratase/lyase; vanillin, | 9e-66 | |
| 3njd_A | 333 | Enoyl-COA hydratase; ssgcid, mycobacerium smegmati | 4e-45 | |
| 3i47_A | 268 | Enoyl COA hydratase/isomerase (crotonase); structu | 9e-45 | |
| 2a7k_A | 250 | CARB; crotonase, antibiotic, beta-lactam, biosynth | 1e-44 | |
| 3myb_A | 286 | Enoyl-COA hydratase; ssgcid, struct genomics, seat | 5e-44 | |
| 3qmj_A | 256 | Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, | 6e-44 | |
| 3lke_A | 263 | Enoyl-COA hydratase; nysgrc, target 11251J, struct | 8e-44 | |
| 2ej5_A | 257 | Enoyl-COA hydratase subunit II; structural genomic | 4e-43 | |
| 3sll_A | 290 | Probable enoyl-COA hydratase/isomerase; structural | 5e-43 | |
| 1uiy_A | 253 | Enoyl-COA hydratase; lyase, beta-oxidation, croton | 7e-43 | |
| 3r9t_A | 267 | ECHA1_1; ssgcid, seattle structural genomics cente | 1e-42 | |
| 1nzy_A | 269 | Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogen | 1e-42 | |
| 3hp0_A | 267 | Putative polyketide biosynthesis enoyl-COA hydrata | 1e-42 | |
| 3kqf_A | 265 | Enoyl-COA hydratase/isomerase family protein; IDP0 | 2e-42 | |
| 3g64_A | 279 | Putative enoyl-COA hydratase; alpha-beta structure | 2e-42 | |
| 3rrv_A | 276 | Enoyl-COA hydratase/isomerase; structural genomics | 3e-42 | |
| 3swx_A | 265 | Probable enoyl-COA hydratase/isomerase; structural | 3e-42 | |
| 3gow_A | 254 | PAAG, probable enoyl-COA hydratase; the spiral fol | 4e-42 | |
| 2q35_A | 243 | CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} | 4e-42 | |
| 3p5m_A | 255 | Enoyl-COA hydratase/isomerase; seattle structural | 5e-42 | |
| 3qk8_A | 272 | Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SB | 5e-42 | |
| 2vx2_A | 287 | Enoyl-COA hydratase domain-containing protein 3; i | 6e-42 | |
| 3qxz_A | 265 | Enoyl-COA hydratase/isomerase; structural genomics | 6e-42 | |
| 3isa_A | 254 | Putative enoyl-COA hydratase/isomerase; structural | 9e-42 | |
| 3fdu_A | 266 | Putative enoyl-COA hydratase/isomerase; structural | 1e-41 | |
| 1szo_A | 257 | 6-oxocamphor hydrolase; enzyme-product complex; HE | 2e-41 | |
| 2j5g_A | 263 | ALR4455 protein; enzyme evolution, C-C bond hydrol | 4e-41 | |
| 3qre_A | 298 | Enoyl-COA hydratase, ECHA12_1; structural genomics | 4e-41 | |
| 3tlf_A | 274 | Enoyl-COA hydratase/isomerase; structural genomics | 5e-41 | |
| 3l3s_A | 263 | Enoyl-COA hydratase/isomerase family protein; crot | 6e-41 | |
| 3he2_A | 264 | Enoyl-COA hydratase ECHA6; fatty acid metabolism, | 9e-41 | |
| 4f47_A | 278 | Enoyl-COA hydratase ECHA19; ssgcid, seattle struct | 1e-40 | |
| 3rsi_A | 265 | Putative enoyl-COA hydratase/isomerase; structural | 1e-40 | |
| 3pe8_A | 256 | Enoyl-COA hydratase; emerald biostructures, struct | 1e-40 | |
| 2pbp_A | 258 | Enoyl-COA hydratase subunit I; B-oxidation, struct | 2e-40 | |
| 3qxi_A | 265 | Enoyl-COA hydratase ECHA1; structural genomics, se | 3e-40 | |
| 1wz8_A | 264 | Enoyl-COA hydratase; lyase, crotonase, hexamer, st | 3e-40 | |
| 3lao_A | 258 | Enoyl-COA hydratase/isomerase; alpha-beta sandwich | 3e-40 | |
| 1hzd_A | 272 | AUH, AU-binding protein/enoyl-COA hydratase; RNA-b | 5e-40 | |
| 3oc7_A | 267 | Enoyl-COA hydratase; seattle structural genomics c | 2e-39 | |
| 3moy_A | 263 | Probable enoyl-COA hydratase; ssgcid, seattle stru | 2e-39 | |
| 2gtr_A | 261 | CDY-like, chromodomain Y-like protein; structural | 1e-38 | |
| 2f6q_A | 280 | Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxis | 1e-38 | |
| 1mj3_A | 260 | Enoyl-COA hydratase, mitochondrial; homohexamer, l | 3e-38 | |
| 3r9q_A | 262 | Enoyl-COA hydratase/isomerase; ssgcid, lyase,isome | 4e-38 | |
| 3hin_A | 275 | Putative 3-hydroxybutyryl-COA dehydratase; structu | 4e-38 | |
| 3gkb_A | 287 | Putative enoyl-COA hydratase; structural genomics, | 7e-38 | |
| 3trr_A | 256 | Probable enoyl-COA hydratase/isomerase; ssgcid, st | 1e-37 | |
| 3h81_A | 278 | Enoyl-COA hydratase ECHA8; niaid, decode, infectio | 1e-37 | |
| 2fbm_A | 291 | Y chromosome chromodomain protein 1, telomeric IS; | 1e-37 | |
| 1ef8_A | 261 | Methylmalonyl COA decarboxylase; lyase; 1.85A {Esc | 5e-37 | |
| 2ppy_A | 265 | Enoyl-COA hydratase; beta-oxidation, fatty acid me | 6e-37 | |
| 3pea_A | 261 | Enoyl-COA hydratase/isomerase family protein; stru | 3e-36 | |
| 3h0u_A | 289 | Putative enoyl-COA hydratase; structural genomics, | 5e-36 | |
| 1pjh_A | 280 | Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral | 2e-35 | |
| 4di1_A | 277 | Enoyl-COA hydratase ECHA17; structural genomics, s | 2e-35 | |
| 2np9_A | 440 | DPGC; protein inhibitor complex, oxidoreductase; H | 1e-34 | |
| 1dci_A | 275 | Dienoyl-COA isomerase; lyase; 1.50A {Rattus norveg | 5e-34 | |
| 1sg4_A | 260 | 3,2-trans-enoyl-COA isomerase, mitochondrial; crot | 6e-34 | |
| 3r6h_A | 233 | Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium m | 3e-33 | |
| 3m6n_A | 305 | RPFF protein; enoyl-COA hydratase, lyase; 1.80A {X | 1e-29 | |
| 3ot6_A | 232 | Enoyl-COA hydratase/isomerase family protein; stru | 4e-29 | |
| 2w3p_A | 556 | Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ri | 1e-26 | |
| 3bpt_A | 363 | 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, bet | 1e-18 | |
| 3ju1_A | 407 | Enoyl-COA hydratase/isomerase family protein; alph | 4e-18 | |
| 2wtb_A | 725 | MFP2, fatty acid multifunctional protein (ATMFP2); | 9e-17 | |
| 1wdk_A | 715 | Fatty oxidation complex alpha subunit; alpha2BETA2 | 2e-16 | |
| 3zwc_A | 742 | Peroxisomal bifunctional enzyme; beta oxidation pa | 5e-14 |
| >2uzf_A Naphthoate synthase; lyase, menaquinone biosynthesis; HET: CAA; 2.9A {Staphylococcus aureus} Length = 273 | Back alignment and structure |
|---|
Score = 270 bits (692), Expect = 8e-92
Identities = 106/159 (66%), Positives = 124/159 (77%), Gaps = 2/159 (1%)
Query: 63 ESGTEFTDIIYEKAVGEGIAKITINRPDRRNAFRPHTVKELIRAFNDARDDSSVGVIILT 122
E+ E+ +I YE EGIAK+TINRP+ RNAF P TV E+I AF+ ARDD +V VI+LT
Sbjct: 7 ETLREYDEIKYEFY--EGIAKVTINRPEVRNAFTPKTVAEMIDAFSRARDDQNVSVIVLT 64
Query: 123 GKGTEAFCSGGDQALRTRDGYADYENFGRLNVLDLQVQIRRLPKPVIAMVAGYAVGGGHV 182
G+G AFCSGGDQ R GY + RLNVLDLQ IR +PKPVIAMV GYAVGGG+V
Sbjct: 65 GEGDLAFCSGGDQKKRGHGGYVGEDQIPRLNVLDLQRLIRIIPKPVIAMVKGYAVGGGNV 124
Query: 183 LHMVCDLTIAADNAIFGQTGPKVGSFDAGYGSSIMSRLV 221
L++VCDLTIAADNAIFGQTGPKVGSFDAGYGS ++R+V
Sbjct: 125 LNVVCDLTIAADNAIFGQTGPKVGSFDAGYGSGYLARIV 163
|
| >3t89_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.95A {Escherichia coli} PDB: 3t88_A 3h02_A 2iex_A Length = 289 | Back alignment and structure |
|---|
| >4eml_A Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coenzyme A, lyase; 2.04A {Synechocystis SP} Length = 275 | Back alignment and structure |
|---|
| >3t8b_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.65A {Mycobacterium tuberculosis} PDB: 3t8a_A 1rjm_A* 1rjn_A* 1q52_A 1q51_A Length = 334 | Back alignment and structure |
|---|
| >3t3w_A Probable enoyl-COA hydratase; ssgcid, structural genomics, seattle ST genomics center for infectious disease, lyase; 1.80A {Mycobacterium thermoresistibile} PDB: 3ome_A Length = 279 | Back alignment and structure |
|---|
| >2j5i_A P-hydroxycinnamoyl COA hydratase/lyase; vanillin, aldolase, crotonase, coenzyme-A; 1.8A {Pseudomonas fluorescens} PDB: 2j5i_B 2vss_A* 2j5i_I 2vss_F* 2vsu_A* 2vss_E* 2vsu_F* 2vsu_E* 2vsu_C* Length = 276 | Back alignment and structure |
|---|
| >3njd_A Enoyl-COA hydratase; ssgcid, mycobacerium smegmatis, structu genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium smegmatis} PDB: 3njb_A Length = 333 | Back alignment and structure |
|---|
| >3i47_A Enoyl COA hydratase/isomerase (crotonase); structural genomics; 1.58A {Legionella pneumophila subsp} Length = 268 | Back alignment and structure |
|---|
| >2a7k_A CARB; crotonase, antibiotic, beta-lactam, biosynthetic protein; 2.24A {Pectobacterium carotovorum} SCOP: c.14.1.3 PDB: 2a81_A* Length = 250 | Back alignment and structure |
|---|
| >3myb_A Enoyl-COA hydratase; ssgcid, struct genomics, seattle structural genomics center for infectious lyase; 1.55A {Mycobacterium smegmatis} Length = 286 | Back alignment and structure |
|---|
| >3qmj_A Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium marinum} Length = 256 | Back alignment and structure |
|---|
| >3lke_A Enoyl-COA hydratase; nysgrc, target 11251J, structural genomics, PSI-2, protein structure initiative; 1.70A {Bacillus halodurans} Length = 263 | Back alignment and structure |
|---|
| >2ej5_A Enoyl-COA hydratase subunit II; structural genomics, GK2038, NPPSFA, national project on prote structural and functional analyses; 2.00A {Geobacillus kaustophilus} Length = 257 | Back alignment and structure |
|---|
| >3sll_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.35A {Mycobacterium abscessus} Length = 290 | Back alignment and structure |
|---|
| >1uiy_A Enoyl-COA hydratase; lyase, beta-oxidation, crotonase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.85A {Thermus thermophilus} SCOP: c.14.1.3 Length = 253 | Back alignment and structure |
|---|
| >3r9t_A ECHA1_1; ssgcid, seattle structural genomics center for infectious DI enoyl-COA hydratase, lyase; 1.75A {Mycobacterium avium subsp} PDB: 3r9s_A 3r0o_A Length = 267 | Back alignment and structure |
|---|
| >1nzy_A Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogenase; lyase; HET: BCA; 1.80A {Pseudomonas SP} SCOP: c.14.1.3 PDB: 1jxz_A* 1nzy_B* Length = 269 | Back alignment and structure |
|---|
| >3hp0_A Putative polyketide biosynthesis enoyl-COA hydratase homolog PKSH; polyketide synthase, enoyl COA hydratase,isomerase; 2.32A {Bacillus subtilis} Length = 267 | Back alignment and structure |
|---|
| >3kqf_A Enoyl-COA hydratase/isomerase family protein; IDP02329, structural genomic for structural genomics of infectious diseases, csgid; HET: MSE; 1.80A {Bacillus anthracis} Length = 265 | Back alignment and structure |
|---|
| >3g64_A Putative enoyl-COA hydratase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; 2.05A {Streptomyces coelicolor A3} Length = 279 | Back alignment and structure |
|---|
| >3rrv_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.45A {Mycobacterium avium subsp} Length = 276 | Back alignment and structure |
|---|
| >3swx_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.10A {Mycobacterium abscessus} Length = 265 | Back alignment and structure |
|---|
| >2q35_A CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} PDB: 2q34_A 2q2x_A Length = 243 | Back alignment and structure |
|---|
| >3p5m_A Enoyl-COA hydratase/isomerase; seattle structural genomics center for infectious disease, S coenzyme A, tuberculosis; 2.05A {Mycobacterium avium} Length = 255 | Back alignment and structure |
|---|
| >3qk8_A Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 1.60A {Mycobacterium marinum M} PDB: 3q1t_A Length = 272 | Back alignment and structure |
|---|
| >2vx2_A Enoyl-COA hydratase domain-containing protein 3; isomerase, fatty acid metabolism, transit peptide, lipid Met crontonase, mitochondrion, CAsp; 2.3A {Homo sapiens} Length = 287 | Back alignment and structure |
|---|
| >3qxz_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.35A {Mycobacterium abscessus} Length = 265 | Back alignment and structure |
|---|
| >3isa_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2, protein structure initiative, EN hydratase; 1.76A {Bordetella parapertussis} Length = 254 | Back alignment and structure |
|---|
| >3fdu_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2; 2.00A {Acinetobacter baumannii} Length = 266 | Back alignment and structure |
|---|
| >1szo_A 6-oxocamphor hydrolase; enzyme-product complex; HET: CAX; 1.90A {Rhodococcus SP} SCOP: c.14.1.3 PDB: 1o8u_A Length = 257 | Back alignment and structure |
|---|
| >2j5g_A ALR4455 protein; enzyme evolution, C-C bond hydrolase, hydrolase, lyase, crotonase, biocatalysis, beta-diketone; 1.46A {Anabaena SP} PDB: 2j5s_A* 2j5g_D Length = 263 | Back alignment and structure |
|---|
| >3qre_A Enoyl-COA hydratase, ECHA12_1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.40A {Mycobacterium marinum M} Length = 298 | Back alignment and structure |
|---|
| >3tlf_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, otholog; 2.15A {Mycobacterium avium subsp} Length = 274 | Back alignment and structure |
|---|
| >3l3s_A Enoyl-COA hydratase/isomerase family protein; crotonase superfamily, dimer of trimers, PSI-2, NYSGXRC, structural genomics; 2.32A {Ruegeria pomeroyi} Length = 263 | Back alignment and structure |
|---|
| >3he2_A Enoyl-COA hydratase ECHA6; fatty acid metabolism, lipid metabolism, lyase, structural genomics; HET: PGE; 2.30A {Mycobacterium tuberculosis} Length = 264 | Back alignment and structure |
|---|
| >4f47_A Enoyl-COA hydratase ECHA19; ssgcid, seattle structural genomics center for infectious DI niaid; 1.75A {Mycobacterium marinum} Length = 278 | Back alignment and structure |
|---|
| >3rsi_A Putative enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Mycobacterium abscessus} Length = 265 | Back alignment and structure |
|---|
| >3pe8_A Enoyl-COA hydratase; emerald biostructures, structural genomics, seattle structur genomics center for infectious disease, ssgcid, lyase; 1.60A {Mycobacterium smegmatis} PDB: 3p85_A* 3qyr_A Length = 256 | Back alignment and structure |
|---|
| >2pbp_A Enoyl-COA hydratase subunit I; B-oxidation, structural genomics, NPPSFA, nationa on protein structural and functional analyses; 1.80A {Geobacillus kaustophilus} PDB: 2qq3_A Length = 258 | Back alignment and structure |
|---|
| >3qxi_A Enoyl-COA hydratase ECHA1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.20A {Mycobacterium marinum} Length = 265 | Back alignment and structure |
|---|
| >1wz8_A Enoyl-COA hydratase; lyase, crotonase, hexamer, structural genomics, riken S genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.14.1.3 Length = 264 | Back alignment and structure |
|---|
| >3lao_A Enoyl-COA hydratase/isomerase; alpha-beta sandwich, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Pseudomonas aeruginosa} Length = 258 | Back alignment and structure |
|---|
| >1hzd_A AUH, AU-binding protein/enoyl-COA hydratase; RNA-binding protein,enoyl-COA hydratase, riken structural genomics/proteomics initiative, RSGI; 2.20A {Homo sapiens} SCOP: c.14.1.3 PDB: 2zqq_A 2zqr_A Length = 272 | Back alignment and structure |
|---|
| >3oc7_A Enoyl-COA hydratase; seattle structural genomics center for infectious disease, S non-pathogenic mycobacterium species, ortholog; 1.50A {Mycobacterium avium} Length = 267 | Back alignment and structure |
|---|
| >3moy_A Probable enoyl-COA hydratase; ssgcid, seattle structural genomics center for infectious DI enoyl COA, actinobacteria, lyase; 1.50A {Mycobacterium smegmatis} Length = 263 | Back alignment and structure |
|---|
| >2gtr_A CDY-like, chromodomain Y-like protein; structural genomics, structural genomics consortium, SGC, unknown function; 1.90A {Homo sapiens} PDB: 2fw2_A Length = 261 | Back alignment and structure |
|---|
| >2f6q_A Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxisomes, fatty acid metabolism, STR genomics, structural genomics consortium, SGC; 1.95A {Homo sapiens} SCOP: c.14.1.3 Length = 280 | Back alignment and structure |
|---|
| >1mj3_A Enoyl-COA hydratase, mitochondrial; homohexamer, lyase; HET: HXC; 2.10A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2dub_A* 1dub_A* 1ey3_A* 2hw5_A* Length = 260 | Back alignment and structure |
|---|
| >3r9q_A Enoyl-COA hydratase/isomerase; ssgcid, lyase,isomerase; 2.10A {Mycobacterium abscessus} PDB: 3qka_A Length = 262 | Back alignment and structure |
|---|
| >3hin_A Putative 3-hydroxybutyryl-COA dehydratase; structural genomics, protein structure INI NEW YORK structural genomix research consortium; 2.00A {Rhodopseudomonas palustris} Length = 275 | Back alignment and structure |
|---|
| >3gkb_A Putative enoyl-COA hydratase; structural genomics, unknown function, PSI-2, protein struct initiative; 1.80A {Streptomyces avermitilis} Length = 287 | Back alignment and structure |
|---|
| >3trr_A Probable enoyl-COA hydratase/isomerase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.09A {Mycobacterium abscessus} Length = 256 | Back alignment and structure |
|---|
| >3h81_A Enoyl-COA hydratase ECHA8; niaid, decode, infectious disease, MPCS, fatty acid metaboli metabolism, lyase, structural genomics; 1.80A {Mycobacterium tuberculosis} PDB: 3q0j_A* 3pzk_A 3q0g_A* Length = 278 | Back alignment and structure |
|---|
| >2fbm_A Y chromosome chromodomain protein 1, telomeric IS; acetyltransferase, structural genomics, structural genomics consortium, SGC, unknown function; 2.28A {Homo sapiens} SCOP: c.14.1.3 Length = 291 | Back alignment and structure |
|---|
| >1ef8_A Methylmalonyl COA decarboxylase; lyase; 1.85A {Escherichia coli} SCOP: c.14.1.3 PDB: 1ef9_A* Length = 261 | Back alignment and structure |
|---|
| >2ppy_A Enoyl-COA hydratase; beta-oxidation, fatty acid metabol lyase, structural genomics, NPPSFA; 2.16A {Geobacillus kaustophilus} Length = 265 | Back alignment and structure |
|---|
| >3pea_A Enoyl-COA hydratase/isomerase family protein; structural genomics, center for structural genomics of infec diseases, csgid; HET: FLC PG4; 1.82A {Bacillus anthracis} Length = 261 | Back alignment and structure |
|---|
| >3h0u_A Putative enoyl-COA hydratase; structural genomics, isomerase, PSI-2, protein structure initiative; 1.50A {Streptomyces avermitilis} Length = 289 | Back alignment and structure |
|---|
| >1pjh_A Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral fold, inter-trimer contacts; 2.10A {Saccharomyces cerevisiae} SCOP: c.14.1.3 PDB: 1hno_A 1k39_A* 1hnu_A Length = 280 | Back alignment and structure |
|---|
| >4di1_A Enoyl-COA hydratase ECHA17; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis, ortholog; 2.25A {Mycobacterium marinum} Length = 277 | Back alignment and structure |
|---|
| >2np9_A DPGC; protein inhibitor complex, oxidoreductase; HET: YE1; 2.45A {Streptomyces toyocaensis} PDB: 2pg8_A* Length = 440 | Back alignment and structure |
|---|
| >1dci_A Dienoyl-COA isomerase; lyase; 1.50A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2vre_A Length = 275 | Back alignment and structure |
|---|
| >1sg4_A 3,2-trans-enoyl-COA isomerase, mitochondrial; crotonase fold; HET: CO8; 1.30A {Homo sapiens} SCOP: c.14.1.3 PDB: 1xx4_A Length = 260 | Back alignment and structure |
|---|
| >3r6h_A Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium marinum, structura genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium marinum M} Length = 233 | Back alignment and structure |
|---|
| >3m6n_A RPFF protein; enoyl-COA hydratase, lyase; 1.80A {Xanthomonas campestris PV} PDB: 3m6m_A Length = 305 | Back alignment and structure |
|---|
| >3ot6_A Enoyl-COA hydratase/isomerase family protein; structural genomics, PSI-2, protein structure initiative; 2.50A {Pseudomonas syringae PV} Length = 232 | Back alignment and structure |
|---|
| >2w3p_A Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ring cleaving, burkholderia xenovorans LB400 crotonase; 1.50A {Burkholderia xenovorans} Length = 556 | Back alignment and structure |
|---|
| >3bpt_A 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, beta-hydroxyisobutyryl acid, querceti structural genomics consortium, SGC; HET: QUE; 1.50A {Homo sapiens} Length = 363 | Back alignment and structure |
|---|
| >3ju1_A Enoyl-COA hydratase/isomerase family protein; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 2.30A {Shewanella oneidensis} Length = 407 | Back alignment and structure |
|---|
| >2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Length = 725 | Back alignment and structure |
|---|
| >1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Length = 715 | Back alignment and structure |
|---|
| >3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Length = 742 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 240 | |||
| 3hrx_A | 254 | Probable enoyl-COA hydratase; the spiral fold, the | 100.0 | |
| 4fzw_C | 274 | 1,2-epoxyphenylacetyl-COA isomerase; structural ge | 100.0 | |
| 4fzw_A | 258 | 2,3-dehydroadipyl-COA hydratase; structural genomi | 100.0 | |
| 3pea_A | 261 | Enoyl-COA hydratase/isomerase family protein; stru | 100.0 | |
| 3kqf_A | 265 | Enoyl-COA hydratase/isomerase family protein; IDP0 | 100.0 | |
| 3t8b_A | 334 | 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase | 100.0 | |
| 4eml_A | 275 | Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coe | 100.0 | |
| 3t89_A | 289 | 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase | 100.0 | |
| 3fdu_A | 266 | Putative enoyl-COA hydratase/isomerase; structural | 100.0 | |
| 3hin_A | 275 | Putative 3-hydroxybutyryl-COA dehydratase; structu | 100.0 | |
| 4hdt_A | 353 | 3-hydroxyisobutyryl-COA hydrolase; ssgcid, carniti | 100.0 | |
| 3lke_A | 263 | Enoyl-COA hydratase; nysgrc, target 112 structural | 100.0 | |
| 3i47_A | 268 | Enoyl COA hydratase/isomerase (crotonase); structu | 100.0 | |
| 3gkb_A | 287 | Putative enoyl-COA hydratase; structural genomics, | 100.0 | |
| 3qmj_A | 256 | Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, | 100.0 | |
| 2uzf_A | 273 | Naphthoate synthase; lyase, menaquinone biosynthes | 100.0 | |
| 3gow_A | 254 | PAAG, probable enoyl-COA hydratase; the spiral fol | 100.0 | |
| 3g64_A | 279 | Putative enoyl-COA hydratase; alpha-beta structure | 100.0 | |
| 2ej5_A | 257 | Enoyl-COA hydratase subunit II; structural genomic | 100.0 | |
| 4di1_A | 277 | Enoyl-COA hydratase ECHA17; structural genomics, s | 100.0 | |
| 3he2_A | 264 | Enoyl-COA hydratase ECHA6; fatty acid metabolism, | 100.0 | |
| 3sll_A | 290 | Probable enoyl-COA hydratase/isomerase; structural | 100.0 | |
| 3lao_A | 258 | Enoyl-COA hydratase/isomerase; alpha-beta sandwich | 100.0 | |
| 3p5m_A | 255 | Enoyl-COA hydratase/isomerase; seattle structural | 100.0 | |
| 2j5i_A | 276 | P-hydroxycinnamoyl COA hydratase/lyase; vanillin, | 100.0 | |
| 1nzy_A | 269 | Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogen | 100.0 | |
| 2f6q_A | 280 | Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxis | 100.0 | |
| 3r9q_A | 262 | Enoyl-COA hydratase/isomerase; ssgcid, lyase,isome | 100.0 | |
| 3qxz_A | 265 | Enoyl-COA hydratase/isomerase; structural genomics | 100.0 | |
| 3qre_A | 298 | Enoyl-COA hydratase, ECHA12_1; structural genomics | 100.0 | |
| 2pbp_A | 258 | Enoyl-COA hydratase subunit I; B-oxidation, struct | 100.0 | |
| 3h81_A | 278 | Enoyl-COA hydratase ECHA8; niaid, decode, infectio | 100.0 | |
| 3hp0_A | 267 | Putative polyketide biosynthesis enoyl-COA hydrata | 100.0 | |
| 3moy_A | 263 | Probable enoyl-COA hydratase; ssgcid, seattle stru | 100.0 | |
| 2a7k_A | 250 | CARB; crotonase, antibiotic, beta-lactam, biosynth | 100.0 | |
| 3rrv_A | 276 | Enoyl-COA hydratase/isomerase; structural genomics | 100.0 | |
| 2vx2_A | 287 | Enoyl-COA hydratase domain-containing protein 3; i | 100.0 | |
| 1pjh_A | 280 | Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral | 100.0 | |
| 3njd_A | 333 | Enoyl-COA hydratase; ssgcid, mycobacerium smegmati | 100.0 | |
| 3h0u_A | 289 | Putative enoyl-COA hydratase; structural genomics, | 100.0 | |
| 2ppy_A | 265 | Enoyl-COA hydratase; beta-oxidation, fatty acid me | 100.0 | |
| 3r9t_A | 267 | ECHA1_1; ssgcid, seattle structural genomics cente | 100.0 | |
| 3myb_A | 286 | Enoyl-COA hydratase; ssgcid, struct genomics, seat | 100.0 | |
| 4f47_A | 278 | Enoyl-COA hydratase ECHA19; ssgcid, seattle struct | 100.0 | |
| 1ef8_A | 261 | Methylmalonyl COA decarboxylase; lyase; 1.85A {Esc | 100.0 | |
| 3swx_A | 265 | Probable enoyl-COA hydratase/isomerase; structural | 100.0 | |
| 3l3s_A | 263 | Enoyl-COA hydratase/isomerase family protein; crot | 100.0 | |
| 3pe8_A | 256 | Enoyl-COA hydratase; emerald biostructures, struct | 100.0 | |
| 1hzd_A | 272 | AUH, AU-binding protein/enoyl-COA hydratase; RNA-b | 100.0 | |
| 1dci_A | 275 | Dienoyl-COA isomerase; lyase; 1.50A {Rattus norveg | 100.0 | |
| 3rsi_A | 265 | Putative enoyl-COA hydratase/isomerase; structural | 100.0 | |
| 3tlf_A | 274 | Enoyl-COA hydratase/isomerase; structural genomics | 100.0 | |
| 3r6h_A | 233 | Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium m | 100.0 | |
| 3qk8_A | 272 | Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SB | 100.0 | |
| 2fbm_A | 291 | Y chromosome chromodomain protein 1, telomeric IS; | 100.0 | |
| 3oc7_A | 267 | Enoyl-COA hydratase; seattle structural genomics c | 100.0 | |
| 2gtr_A | 261 | CDY-like, chromodomain Y-like protein; structural | 100.0 | |
| 1wz8_A | 264 | Enoyl-COA hydratase; lyase, crotonase, hexamer, st | 100.0 | |
| 3isa_A | 254 | Putative enoyl-COA hydratase/isomerase; structural | 100.0 | |
| 2j5g_A | 263 | ALR4455 protein; enzyme evolution, C-C bond hydrol | 100.0 | |
| 3t3w_A | 279 | Enoyl-COA hydratase; ssgcid, structural genomics, | 100.0 | |
| 1szo_A | 257 | 6-oxocamphor hydrolase; enzyme-product complex; HE | 100.0 | |
| 3bpt_A | 363 | 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, bet | 100.0 | |
| 1sg4_A | 260 | 3,2-trans-enoyl-COA isomerase, mitochondrial; crot | 100.0 | |
| 3qxi_A | 265 | Enoyl-COA hydratase ECHA1; structural genomics, se | 100.0 | |
| 2q35_A | 243 | CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} | 100.0 | |
| 1uiy_A | 253 | Enoyl-COA hydratase; lyase, beta-oxidation, croton | 100.0 | |
| 3ju1_A | 407 | Enoyl-COA hydratase/isomerase family protein; alph | 100.0 | |
| 3trr_A | 256 | Probable enoyl-COA hydratase/isomerase; ssgcid, st | 100.0 | |
| 3m6n_A | 305 | RPFF protein; enoyl-COA hydratase, lyase; 1.80A {X | 100.0 | |
| 3ot6_A | 232 | Enoyl-COA hydratase/isomerase family protein; stru | 100.0 | |
| 1mj3_A | 260 | Enoyl-COA hydratase, mitochondrial; homohexamer, l | 100.0 | |
| 2np9_A | 440 | DPGC; protein inhibitor complex, oxidoreductase; H | 100.0 | |
| 3zwc_A | 742 | Peroxisomal bifunctional enzyme; beta oxidation pa | 100.0 | |
| 2w3p_A | 556 | Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ri | 100.0 | |
| 1wdk_A | 715 | Fatty oxidation complex alpha subunit; alpha2BETA2 | 100.0 | |
| 2wtb_A | 725 | MFP2, fatty acid multifunctional protein (ATMFP2); | 100.0 | |
| 3bf0_A | 593 | Protease 4; bacterial, hydrolase, inner membrane, | 99.76 | |
| 3rst_A | 240 | Signal peptide peptidase SPPA; alpha/beta protein | 99.67 | |
| 3viv_A | 230 | 441AA long hypothetical NFED protein; protein-pept | 99.66 | |
| 2f9y_B | 304 | Acetyl-coenzyme A carboxylase carboxyl transferas | 99.26 | |
| 1y7o_A | 218 | ATP-dependent CLP protease proteolytic subunit; hy | 99.21 | |
| 2f9i_A | 327 | Acetyl-coenzyme A carboxylase carboxyl transferase | 99.06 | |
| 2f9y_A | 339 | Acetyl-COA carboxylase, carboxyltransferase alpha; | 99.02 | |
| 2cby_A | 208 | ATP-dependent CLP protease proteolytic subunit 1; | 98.07 | |
| 1yg6_A | 193 | ATP-dependent CLP protease proteolytic subunit; en | 97.63 | |
| 3qwd_A | 203 | ATP-dependent CLP protease proteolytic subunit; ca | 97.6 | |
| 2f6i_A | 215 | ATP-dependent CLP protease, putative; structural g | 97.44 | |
| 3p2l_A | 201 | ATP-dependent CLP protease proteolytic subunit; st | 97.25 | |
| 1pix_A | 587 | Glutaconyl-COA decarboxylase A subunit; biotin-dep | 97.19 | |
| 1tg6_A | 277 | Putative ATP-dependent CLP protease proteolytic S; | 97.06 | |
| 1on3_A | 523 | Methylmalonyl-COA carboxyltransferase 12S subunit; | 96.62 | |
| 3iav_A | 530 | Propionyl-COA carboxylase complex B subunit; accas | 96.61 | |
| 2bzr_A | 548 | Propionyl-COA carboxylase beta chain 5; fatty acid | 96.46 | |
| 1x0u_A | 522 | Hypothetical methylmalonyl-COA decarboxylase ALPH; | 96.36 | |
| 2f9i_B | 285 | Acetyl-coenzyme A carboxylase carboxyl transferase | 96.34 | |
| 3n6r_B | 531 | Propionyl-COA carboxylase, beta subunit; protein c | 96.22 | |
| 3bf0_A | 593 | Protease 4; bacterial, hydrolase, inner membrane, | 96.19 | |
| 1vrg_A | 527 | Propionyl-COA carboxylase, beta subunit; TM0716, s | 95.74 | |
| 1x0u_A | 522 | Hypothetical methylmalonyl-COA decarboxylase ALPH; | 95.62 | |
| 3gf3_A | 588 | Glutaconyl-COA decarboxylase subunit A; sodium ION | 95.33 | |
| 3u9r_B | 555 | MCC beta, methylcrotonyl-COA carboxylase, beta-sub | 95.23 | |
| 4gm2_A | 205 | ATP-dependent CLP protease proteolytic subunit; st | 94.8 | |
| 2bzr_A | 548 | Propionyl-COA carboxylase beta chain 5; fatty acid | 94.1 | |
| 1vrg_A | 527 | Propionyl-COA carboxylase, beta subunit; TM0716, s | 94.01 | |
| 3iav_A | 530 | Propionyl-COA carboxylase complex B subunit; accas | 93.88 | |
| 3k8x_A | 758 | Acetyl-COA carboxylase; transferase, carboxyltrans | 93.73 | |
| 1on3_A | 523 | Methylmalonyl-COA carboxyltransferase 12S subunit; | 93.57 | |
| 3n6r_B | 531 | Propionyl-COA carboxylase, beta subunit; protein c | 93.47 | |
| 2x24_A | 793 | Acetyl-COA carboxylase; fatty acid biosynthesis, l | 92.47 | |
| 2w3p_A | 556 | Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ri | 91.76 | |
| 3u9r_B | 555 | MCC beta, methylcrotonyl-COA carboxylase, beta-sub | 90.4 | |
| 1pix_A | 587 | Glutaconyl-COA decarboxylase A subunit; biotin-dep | 89.43 | |
| 3k8x_A | 758 | Acetyl-COA carboxylase; transferase, carboxyltrans | 84.43 | |
| 2x24_A | 793 | Acetyl-COA carboxylase; fatty acid biosynthesis, l | 82.84 |
| >3hrx_A Probable enoyl-COA hydratase; the spiral fold, the crotonase superfamily, lyase; 1.85A {Thermus thermophilus} | Back alignment and structure |
|---|
Probab=100.00 E-value=2.3e-46 Score=322.47 Aligned_cols=163 Identities=26% Similarity=0.359 Sum_probs=148.6
Q ss_pred EEEEEEeCCCEEEEEEcCCCCCCCCCHHHHHHHHHHHHHhhhCCCeeEEEEeeCCCCCcccCCCccccccCCccchhhhh
Q 026342 71 IIYEKAVGEGIAKITINRPDRRNAFRPHTVKELIRAFNDARDDSSVGVIILTGKGTEAFCSGGDQALRTRDGYADYENFG 150 (240)
Q Consensus 71 v~~~~~~~~~v~~Itlnrp~~~Nal~~~~~~~L~~~l~~~~~d~~v~vvVltg~g~~~FcaG~Dl~~~~~~~~~~~~~~~ 150 (240)
|++|+ +|+|++||||||+++|+||.+|+.+|.++|+++++|+++|+|||||.| ++||+|+|++++....... ....
T Consensus 2 vl~E~--~dgVa~itlnrP~~~NAl~~~m~~~L~~al~~~~~d~~vr~vVltg~g-~~F~aG~Dl~~~~~~~~~~-~~~~ 77 (254)
T 3hrx_A 2 VLKER--QDGVLVLTLNRPEKLNAITGELLDALYAALKEGEEDREVRALLLTGAG-RAFSAGQDLTEFGDRKPDY-EAHL 77 (254)
T ss_dssp EEEEE--ETTEEEEEECCGGGTTCBCHHHHHHHHHHHHHHHHCTTCCEEEEEEST-TCSBCCBCGGGTTTSCCCH-HHHT
T ss_pred eEEEE--ECCEEEEEEcCCCcCCCCCHHHHHHHHHHHHHHHhCCCeEEEEEeCCC-CCcccCccHHHhcccchhh-HHHH
Confidence 67787 799999999999999999999999999999999999999999999999 8999999999875433222 2222
Q ss_pred hhhHHHHHHHHHcCCCcEEEEECchhchhhHHHhhhcCEEEEeCCcEEecccccccccCCCchHHHHHhhcCHHHHHHHH
Q 026342 151 RLNVLDLQVQIRRLPKPVIAMVAGYAVGGGHVLHMVCDLTIAADNAIFGQTGPKVGSFDAGYGSSIMSRLVSTVQQCLWW 230 (240)
Q Consensus 151 ~~~~~~l~~~i~~~~kP~IAav~G~a~GgG~~lal~~D~rias~~a~f~~pe~~~Gl~p~~g~~~~l~rlvG~~~a~ell 230 (240)
. .+..++..|.++||||||+|||+|+|||++|+++||||||+++++|++||+++|++|++|++++|+|++|.++|++|+
T Consensus 78 ~-~~~~~~~~l~~~~kPvIAav~G~a~GgG~~lalacD~ria~~~a~f~~pe~~lGl~p~~g~~~~L~r~vG~~~A~~ll 156 (254)
T 3hrx_A 78 R-RYNRVVEALSGLEKPLVVAVNGVAAGAGMSLALWGDLRLAAVGASFTTAFVRIGLVPDSGLSFLLPRLVGLAKAQELL 156 (254)
T ss_dssp H-HHHHHHHHHHTCSSCEEEEECSEEETHHHHHHTTCSEEEEETTCEEECCGGGGTCCCCTTHHHHHHHHHCHHHHHHHH
T ss_pred H-HHHHHHHHHHhCCCCEEEEECCEeeehhhhhhhccceeeEcCCCEEEchhhCcCcCCcccHHHHHHHHhCcchHHHHh
Confidence 2 356778899999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hcCCcccc
Q 026342 231 GLKKHVKC 238 (240)
Q Consensus 231 ltG~~i~A 238 (240)
+||+.|+|
T Consensus 157 ltg~~i~A 164 (254)
T 3hrx_A 157 LLSPRLSA 164 (254)
T ss_dssp HHCCCEEH
T ss_pred hcCcccCH
Confidence 99999986
|
| >4fzw_C 1,2-epoxyphenylacetyl-COA isomerase; structural genomics, montreal-kingston bacterial structural initiative, BSGI, crotonase fold; 2.55A {Escherichia coli} | Back alignment and structure |
|---|
| >4fzw_A 2,3-dehydroadipyl-COA hydratase; structural genomics, montreal-kingston bacterial structural initiative, BSGI, crotonase fold; 2.55A {Escherichia coli} | Back alignment and structure |
|---|
| >3pea_A Enoyl-COA hydratase/isomerase family protein; structural genomics, center for structural genomics of infec diseases, csgid; HET: FLC PG4; 1.82A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3kqf_A Enoyl-COA hydratase/isomerase family protein; IDP02329, structural genomic for structural genomics of infectious diseases, csgid; HET: MSE; 1.80A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3t8b_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.65A {Mycobacterium tuberculosis} PDB: 3t8a_A 1rjm_A* 1rjn_A* 1q52_A 1q51_A | Back alignment and structure |
|---|
| >4eml_A Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coenzyme A, lyase; 2.04A {Synechocystis SP} | Back alignment and structure |
|---|
| >3t89_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.95A {Escherichia coli} PDB: 3t88_A 4elx_A 4elw_A 4els_A 3h02_A 2iex_A | Back alignment and structure |
|---|
| >3fdu_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2; 2.00A {Acinetobacter baumannii} | Back alignment and structure |
|---|
| >3hin_A Putative 3-hydroxybutyryl-COA dehydratase; structural genomics, protein structure INI NEW YORK structural genomix research consortium; 2.00A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >4hdt_A 3-hydroxyisobutyryl-COA hydrolase; ssgcid, carnitinyl-COA dehydratase, enoyl-COA hydratase/ISOM mycobacterium thermoresistibIle; 1.60A {Mycobacterium thermoresistibile} | Back alignment and structure |
|---|
| >3lke_A Enoyl-COA hydratase; nysgrc, target 112 structural genomics, PSI-2, protein structure initiative; 1.70A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3i47_A Enoyl COA hydratase/isomerase (crotonase); structural genomics; 1.58A {Legionella pneumophila subsp} SCOP: c.14.1.0 | Back alignment and structure |
|---|
| >3gkb_A Putative enoyl-COA hydratase; structural genomics, unknown function, PSI-2, protein struct initiative; 1.80A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >3qmj_A Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >2uzf_A Naphthoate synthase; lyase, menaquinone biosynthesis; HET: CAA; 2.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3g64_A Putative enoyl-COA hydratase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; 2.05A {Streptomyces coelicolor A3} | Back alignment and structure |
|---|
| >2ej5_A Enoyl-COA hydratase subunit II; structural genomics, GK2038, NPPSFA, national project on prote structural and functional analyses; 2.00A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >4di1_A Enoyl-COA hydratase ECHA17; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis, ortholog; 2.25A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >3he2_A Enoyl-COA hydratase ECHA6; fatty acid metabolism, lipid metabolism, lyase, structural genomics; HET: PGE; 2.30A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3sll_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.35A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >3lao_A Enoyl-COA hydratase/isomerase; alpha-beta sandwich, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3p5m_A Enoyl-COA hydratase/isomerase; seattle structural genomics center for infectious disease, S coenzyme A, tuberculosis; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
| >2j5i_A P-hydroxycinnamoyl COA hydratase/lyase; vanillin, aldolase, crotonase, coenzyme-A; 1.8A {Pseudomonas fluorescens} PDB: 2j5i_B 2vss_A* 2j5i_I 2vss_F* 2vsu_A* 2vss_E* 2vsu_F* 2vsu_E* 2vsu_C* | Back alignment and structure |
|---|
| >1nzy_A Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogenase; lyase; HET: BCA; 1.80A {Pseudomonas SP} SCOP: c.14.1.3 PDB: 1jxz_A* 1nzy_B* | Back alignment and structure |
|---|
| >2f6q_A Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxisomes, fatty acid metabolism, STR genomics, structural genomics consortium, SGC; 1.95A {Homo sapiens} SCOP: c.14.1.3 | Back alignment and structure |
|---|
| >3r9q_A Enoyl-COA hydratase/isomerase; ssgcid, lyase,isomerase; 2.10A {Mycobacterium abscessus} PDB: 3qka_A | Back alignment and structure |
|---|
| >3qxz_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.35A {Mycobacterium abscessus} SCOP: c.14.1.0 | Back alignment and structure |
|---|
| >3qre_A Enoyl-COA hydratase, ECHA12_1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.40A {Mycobacterium marinum M} | Back alignment and structure |
|---|
| >2pbp_A Enoyl-COA hydratase subunit I; B-oxidation, structural genomics, NPPSFA, nationa on protein structural and functional analyses; 1.80A {Geobacillus kaustophilus} PDB: 2qq3_A | Back alignment and structure |
|---|
| >3h81_A Enoyl-COA hydratase ECHA8; niaid, decode, infectious disease, MPCS, fatty acid metaboli metabolism, lyase, structural genomics; 1.80A {Mycobacterium tuberculosis} PDB: 3q0j_A* 3pzk_A 3q0g_A* | Back alignment and structure |
|---|
| >3hp0_A Putative polyketide biosynthesis enoyl-COA hydratase homolog PKSH; polyketide synthase, enoyl COA hydratase,isomerase; 2.32A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3moy_A Probable enoyl-COA hydratase; ssgcid, seattle structural genomics center for infectious DI enoyl COA, actinobacteria, lyase; 1.50A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >2a7k_A CARB; crotonase, antibiotic, beta-lactam, biosynthetic protein; 2.24A {Pectobacterium carotovorum} SCOP: c.14.1.3 PDB: 2a81_A* | Back alignment and structure |
|---|
| >3rrv_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.45A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >2vx2_A Enoyl-COA hydratase domain-containing protein 3; isomerase, fatty acid metabolism, transit peptide, lipid Met crontonase, mitochondrion, CAsp; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >1pjh_A Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral fold, inter-trimer contacts; 2.10A {Saccharomyces cerevisiae} SCOP: c.14.1.3 PDB: 1hno_A 1k39_A* 1hnu_A | Back alignment and structure |
|---|
| >3njd_A Enoyl-COA hydratase; ssgcid, mycobacerium smegmatis, structu genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium smegmatis} PDB: 3njb_A | Back alignment and structure |
|---|
| >3h0u_A Putative enoyl-COA hydratase; structural genomics, isomerase, PSI-2, protein structure initiative; 1.50A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >2ppy_A Enoyl-COA hydratase; beta-oxidation, fatty acid metabol lyase, structural genomics, NPPSFA; 2.16A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >3r9t_A ECHA1_1; ssgcid, seattle structural genomics center for infectious DI enoyl-COA hydratase, lyase; 1.75A {Mycobacterium avium subsp} SCOP: c.14.1.0 PDB: 3r9s_A 3r0o_A | Back alignment and structure |
|---|
| >3myb_A Enoyl-COA hydratase; ssgcid, struct genomics, seattle structural genomics center for infectious lyase; 1.55A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >4f47_A Enoyl-COA hydratase ECHA19; ssgcid, seattle structural genomics center for infectious DI niaid; 1.75A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >1ef8_A Methylmalonyl COA decarboxylase; lyase; 1.85A {Escherichia coli} SCOP: c.14.1.3 PDB: 1ef9_A* | Back alignment and structure |
|---|
| >3swx_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.10A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >3l3s_A Enoyl-COA hydratase/isomerase family protein; crotonase superfamily, dimer of trimers, PSI-2, NYSGXRC, structural genomics; 2.32A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >3pe8_A Enoyl-COA hydratase; emerald biostructures, structural genomics, seattle structur genomics center for infectious disease, ssgcid, lyase; 1.60A {Mycobacterium smegmatis} PDB: 3p85_A* 3qyr_A | Back alignment and structure |
|---|
| >1hzd_A AUH, AU-binding protein/enoyl-COA hydratase; RNA-binding protein,enoyl-COA hydratase, riken structural genomics/proteomics initiative, RSGI; 2.20A {Homo sapiens} SCOP: c.14.1.3 PDB: 2zqq_A 2zqr_A | Back alignment and structure |
|---|
| >1dci_A Dienoyl-COA isomerase; lyase; 1.50A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2vre_A | Back alignment and structure |
|---|
| >3rsi_A Putative enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >3tlf_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, otholog; 2.15A {Mycobacterium avium subsp} SCOP: c.14.1.0 | Back alignment and structure |
|---|
| >3r6h_A Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium marinum, structura genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium marinum M} PDB: 4hc8_A* | Back alignment and structure |
|---|
| >3qk8_A Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 1.60A {Mycobacterium marinum M} SCOP: c.14.1.0 PDB: 3q1t_A | Back alignment and structure |
|---|
| >2fbm_A Y chromosome chromodomain protein 1, telomeric IS; acetyltransferase, structural genomics, structural genomics consortium, SGC, unknown function; 2.28A {Homo sapiens} SCOP: c.14.1.3 | Back alignment and structure |
|---|
| >3oc7_A Enoyl-COA hydratase; seattle structural genomics center for infectious disease, S non-pathogenic mycobacterium species, ortholog; 1.50A {Mycobacterium avium} SCOP: c.14.1.0 | Back alignment and structure |
|---|
| >2gtr_A CDY-like, chromodomain Y-like protein; structural genomics, structural genomics consortium, SGC, unknown function; 1.90A {Homo sapiens} PDB: 2fw2_A | Back alignment and structure |
|---|
| >1wz8_A Enoyl-COA hydratase; lyase, crotonase, hexamer, structural genomics, riken S genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.14.1.3 | Back alignment and structure |
|---|
| >3isa_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2, protein structure initiative, EN hydratase; 1.76A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2j5g_A ALR4455 protein; enzyme evolution, C-C bond hydrolase, hydrolase, lyase, crotonase, biocatalysis, beta-diketone; 1.46A {Anabaena SP} PDB: 2j5s_A* 2j5g_D | Back alignment and structure |
|---|
| >3t3w_A Enoyl-COA hydratase; ssgcid, structural genomics, seattle ST genomics center for infectious disease, lyase; 1.80A {Mycobacterium thermoresistibile} PDB: 3ome_A | Back alignment and structure |
|---|
| >1szo_A 6-oxocamphor hydrolase; enzyme-product complex; HET: CAX; 1.90A {Rhodococcus SP} SCOP: c.14.1.3 PDB: 1o8u_A | Back alignment and structure |
|---|
| >3bpt_A 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, beta-hydroxyisobutyryl acid, querceti structural genomics consortium, SGC; HET: QUE; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1sg4_A 3,2-trans-enoyl-COA isomerase, mitochondrial; crotonase fold; HET: CO8; 1.30A {Homo sapiens} SCOP: c.14.1.3 PDB: 1xx4_A | Back alignment and structure |
|---|
| >3qxi_A Enoyl-COA hydratase ECHA1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.20A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >2q35_A CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} PDB: 2q34_A 2q2x_A | Back alignment and structure |
|---|
| >1uiy_A Enoyl-COA hydratase; lyase, beta-oxidation, crotonase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.85A {Thermus thermophilus} SCOP: c.14.1.3 | Back alignment and structure |
|---|
| >3ju1_A Enoyl-COA hydratase/isomerase family protein; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 2.30A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >3trr_A Probable enoyl-COA hydratase/isomerase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.09A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >3m6n_A RPFF protein; enoyl-COA hydratase, lyase; 1.80A {Xanthomonas campestris PV} PDB: 3m6m_A | Back alignment and structure |
|---|
| >3ot6_A Enoyl-COA hydratase/isomerase family protein; structural genomics, PSI-2, protein structure initiative; 2.50A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >1mj3_A Enoyl-COA hydratase, mitochondrial; homohexamer, lyase; HET: HXC; 2.10A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2dub_A* 1dub_A* 1ey3_A* 2hw5_A* | Back alignment and structure |
|---|
| >2np9_A DPGC; protein inhibitor complex, oxidoreductase; HET: YE1; 2.45A {Streptomyces toyocaensis} PDB: 2pg8_A* | Back alignment and structure |
|---|
| >3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* | Back alignment and structure |
|---|
| >2w3p_A Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ring cleaving, burkholderia xenovorans LB400 crotonase; 1.50A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* | Back alignment and structure |
|---|
| >2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3bf0_A Protease 4; bacterial, hydrolase, inner membrane, membrane, transmembrane; 2.55A {Escherichia coli} PDB: 3bez_A | Back alignment and structure |
|---|
| >3rst_A Signal peptide peptidase SPPA; alpha/beta protein fold, signal peptide digestion, bacterial membrane, hydrolase; 2.37A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3viv_A 441AA long hypothetical NFED protein; protein-peptide complex, alpha / beta motif, protease, membr protein stomatin, hydrolase-protein binding complex; 2.25A {Pyrococcus horikoshii} PDB: 3bpp_A 2deo_A | Back alignment and structure |
|---|
| >2f9y_B Acetyl-coenzyme A carboxylase carboxyl transferas beta; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4 | Back alignment and structure |
|---|
| >1y7o_A ATP-dependent CLP protease proteolytic subunit; hydrolase; 2.51A {Streptococcus pneumoniae} SCOP: c.14.1.1 | Back alignment and structure |
|---|
| >2f9i_A Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2f9y_A Acetyl-COA carboxylase, carboxyltransferase alpha; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4 | Back alignment and structure |
|---|
| >2cby_A ATP-dependent CLP protease proteolytic subunit 1; serine protease, endopept mycobacterium tuberculosis, ATP-dependent protease; 2.6A {Mycobacterium tuberculosis} SCOP: c.14.1.1 PDB: 2c8t_A 2ce3_A | Back alignment and structure |
|---|
| >1yg6_A ATP-dependent CLP protease proteolytic subunit; endopeptidase CLP, caseinolytic protease, protease TI, heat shock protein F21.5, hydrolase; 1.90A {Escherichia coli} SCOP: c.14.1.1 PDB: 1tyf_A 2fzs_A* 3mt6_R 1yg8_A 3hln_A 2zl2_A 2zl0_A 2zl4_A 2zl3_A 3tt7_A* 3tt6_A 3ktg_A 3kth_A 3kti_A* 3ktj_A* 3ktk_A* 3q7h_A | Back alignment and structure |
|---|
| >3qwd_A ATP-dependent CLP protease proteolytic subunit; caseinolytic protease, serin-protease, hydrolase; 2.10A {Staphylococcus aureus subsp} SCOP: c.14.1.1 PDB: 3v5e_A 3v5i_A 3sta_V 3st9_A | Back alignment and structure |
|---|
| >2f6i_A ATP-dependent CLP protease, putative; structural genomics, structural genomics conso SGC, hydrolase; 2.45A {Plasmodium falciparum} SCOP: c.14.1.1 | Back alignment and structure |
|---|
| >3p2l_A ATP-dependent CLP protease proteolytic subunit; structural genomics, center for structural genomics of infec diseases, csgid; 2.29A {Francisella tularensis subsp} SCOP: c.14.1.1 | Back alignment and structure |
|---|
| >1pix_A Glutaconyl-COA decarboxylase A subunit; biotin-dependent ION pump, carboxyltransferase, lyase; 2.20A {Acidaminococcus fermentans} SCOP: c.14.1.4 c.14.1.4 | Back alignment and structure |
|---|
| >1tg6_A Putative ATP-dependent CLP protease proteolytic S; mitochondrial CLPP, CLP/HSP 100, ATP-dependent protease, HYD; HET: FME; 2.10A {Homo sapiens} SCOP: c.14.1.1 | Back alignment and structure |
|---|
| >1on3_A Methylmalonyl-COA carboxyltransferase 12S subunit; domain duplication, multienzyme complex, transcarboxylase; HET: MCA; 1.90A {Propionibacterium freudenreichii} SCOP: c.14.1.4 c.14.1.4 PDB: 1on9_A* | Back alignment and structure |
|---|
| >3iav_A Propionyl-COA carboxylase complex B subunit; accase, pccase, ACC, PCC, CT, carboxyltransfe polyketide, fatty acid, PKS, FAS; 1.75A {Streptomyces coelicolor} PDB: 1xnw_A 3ib9_A* 3ibb_A 3mfm_C 1xny_A* 1xnv_A* 1xo6_A | Back alignment and structure |
|---|
| >2bzr_A Propionyl-COA carboxylase beta chain 5; fatty acid biosynthesis, accase, ligase, transferase; 2.2A {Mycobacterium tuberculosis} PDB: 2a7s_A | Back alignment and structure |
|---|
| >1x0u_A Hypothetical methylmalonyl-COA decarboxylase ALPH; lyase; 2.20A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2f9i_B Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3n6r_B Propionyl-COA carboxylase, beta subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Roseobacter denitrificans} | Back alignment and structure |
|---|
| >3bf0_A Protease 4; bacterial, hydrolase, inner membrane, membrane, transmembrane; 2.55A {Escherichia coli} PDB: 3bez_A | Back alignment and structure |
|---|
| >1vrg_A Propionyl-COA carboxylase, beta subunit; TM0716, structural joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE; 2.30A {Thermotoga maritima} SCOP: c.14.1.4 c.14.1.4 | Back alignment and structure |
|---|
| >1x0u_A Hypothetical methylmalonyl-COA decarboxylase ALPH; lyase; 2.20A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3gf3_A Glutaconyl-COA decarboxylase subunit A; sodium ION transport, biotin, glutamate fermentation, lyase; HET: COO; 1.75A {Clostridium symbiosum} PDB: 3gf7_A 3glm_A* 3gma_A* | Back alignment and structure |
|---|
| >3u9r_B MCC beta, methylcrotonyl-COA carboxylase, beta-subunit; carboxyltransferase, beta-BETA-alpha superhelix, ligase; HET: 1PE; 1.50A {Pseudomonas aeruginosa} PDB: 3u9s_B* 3u9t_B | Back alignment and structure |
|---|
| >4gm2_A ATP-dependent CLP protease proteolytic subunit; structural genomics, structural genomics consortium, SGC, PR hydrolase; 2.80A {Plasmodium falciparum} PDB: 4hnk_A | Back alignment and structure |
|---|
| >2bzr_A Propionyl-COA carboxylase beta chain 5; fatty acid biosynthesis, accase, ligase, transferase; 2.2A {Mycobacterium tuberculosis} PDB: 2a7s_A | Back alignment and structure |
|---|
| >1vrg_A Propionyl-COA carboxylase, beta subunit; TM0716, structural joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE; 2.30A {Thermotoga maritima} SCOP: c.14.1.4 c.14.1.4 | Back alignment and structure |
|---|
| >3iav_A Propionyl-COA carboxylase complex B subunit; accase, pccase, ACC, PCC, CT, carboxyltransfe polyketide, fatty acid, PKS, FAS; 1.75A {Streptomyces coelicolor} PDB: 1xnw_A 3ib9_A* 3ibb_A 3mfm_C 1xny_A* 1xnv_A* 1xo6_A | Back alignment and structure |
|---|
| >3k8x_A Acetyl-COA carboxylase; transferase, carboxyltransferase, AC tepraloxydim, ATP-binding, biotin, fatty acid biosynthesis; HET: B89; 2.30A {Saccharomyces cerevisiae} PDB: 1w2x_A* 3h0s_A* 3h0j_A* 3h0q_A* 1od2_A* 1od4_A* 3pgq_A* 3tvu_A* 3tv5_A* 3tvw_A* 3tz3_A* 1uyr_A* 1uys_A* 1uyt_A 1uyv_A | Back alignment and structure |
|---|
| >1on3_A Methylmalonyl-COA carboxyltransferase 12S subunit; domain duplication, multienzyme complex, transcarboxylase; HET: MCA; 1.90A {Propionibacterium freudenreichii} SCOP: c.14.1.4 c.14.1.4 PDB: 1on9_A* | Back alignment and structure |
|---|
| >3n6r_B Propionyl-COA carboxylase, beta subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Roseobacter denitrificans} | Back alignment and structure |
|---|
| >2x24_A Acetyl-COA carboxylase; fatty acid biosynthesis, ligase, lipid synthesis; HET: X24; 2.40A {Bos taurus} PDB: 3ff6_A* 3tdc_A* | Back alignment and structure |
|---|
| >2w3p_A Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ring cleaving, burkholderia xenovorans LB400 crotonase; 1.50A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >3u9r_B MCC beta, methylcrotonyl-COA carboxylase, beta-subunit; carboxyltransferase, beta-BETA-alpha superhelix, ligase; HET: 1PE; 1.50A {Pseudomonas aeruginosa} PDB: 3u9s_B* 3u9t_B | Back alignment and structure |
|---|
| >1pix_A Glutaconyl-COA decarboxylase A subunit; biotin-dependent ION pump, carboxyltransferase, lyase; 2.20A {Acidaminococcus fermentans} SCOP: c.14.1.4 c.14.1.4 | Back alignment and structure |
|---|
| >3k8x_A Acetyl-COA carboxylase; transferase, carboxyltransferase, AC tepraloxydim, ATP-binding, biotin, fatty acid biosynthesis; HET: B89; 2.30A {Saccharomyces cerevisiae} PDB: 1w2x_A* 3h0s_A* 3h0j_A* 3h0q_A* 1od2_A* 1od4_A* 3pgq_A* 3tvu_A* 3tv5_A* 3tvw_A* 3tz3_A* 1uyr_A* 1uys_A* 1uyt_A 1uyv_A | Back alignment and structure |
|---|
| >2x24_A Acetyl-COA carboxylase; fatty acid biosynthesis, ligase, lipid synthesis; HET: X24; 2.40A {Bos taurus} PDB: 3ff6_A* 3tdc_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 240 | ||||
| d1mj3a_ | 260 | c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Rat | 5e-36 | |
| d1q52a_ | 297 | c.14.1.3 (A:) Naphthoate synthase MenB {Mycobacter | 7e-28 | |
| d1dcia_ | 275 | c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2 | 8e-24 | |
| d1uiya_ | 253 | c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {The | 3e-22 | |
| d1nzya_ | 269 | c.14.1.3 (A:) 4-Chlorobenzoyl-CoA dehalogenase {Ps | 9e-20 | |
| d2f6qa1 | 245 | c.14.1.3 (A:108-352) Peroxisomal 3,2-trans-enoyl-C | 5e-17 | |
| d1hzda_ | 266 | c.14.1.3 (A:) AUH protein {Human (Homo sapiens) [T | 7e-17 | |
| d1wdka4 | 310 | c.14.1.3 (A:1-310) Fatty oxidation complex alpha s | 4e-15 | |
| d1ef8a_ | 261 | c.14.1.3 (A:) Methylmalonyl CoA decarboxylase {Esc | 2e-13 | |
| d1pjha_ | 266 | c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2 | 5e-13 | |
| d1szoa_ | 249 | c.14.1.3 (A:) 6-oxo camphor hydrolase {Rhodococcus | 1e-11 | |
| d1wz8a1 | 263 | c.14.1.3 (A:2-264) Probable enoyl-CoA hydratase TT | 6e-11 | |
| d2fw2a1 | 258 | c.14.1.3 (A:3-260) Chromodomain protein CDY2A {Hum | 7e-11 | |
| d2a7ka1 | 230 | c.14.1.3 (A:1-230) Carbapenem biosynthes protein C | 1e-09 | |
| d1sg4a1 | 249 | c.14.1.3 (A:2-250) Dienoyl-CoA isomerase (delta3-d | 7e-09 | |
| d1uyra1 | 333 | c.14.1.4 (A:1482-1814) Acetyl-coenzyme A carboxyla | 0.001 |
| >d1mj3a_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 260 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: ClpP/crotonase superfamily: ClpP/crotonase family: Crotonase-like domain: Enoyl-CoA hydratase (crotonase) species: Rat (Rattus norvegicus) [TaxId: 10116]
Score = 126 bits (316), Expect = 5e-36
Identities = 51/155 (32%), Positives = 72/155 (46%), Gaps = 5/155 (3%)
Query: 68 FTDIIYEK-AVGEGIAKITINRPDRRNAFRPHTVKELIRAFNDARDDSSVGVIILTGKGT 126
F II EK + I +NRP NA ++EL +A +D +VG I+LTG
Sbjct: 3 FQYIITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEK 62
Query: 127 EAFCSGGDQALRTRDGYADYENFGRLNVLDLQVQIRRLPKPVIAMVAGYAVGGGHVLHMV 186
+ ++ R Y L I R+ KPVIA V GYA+GGG L M+
Sbjct: 63 AFAAGADIKEMQNRTFQDCYSG----KFLSHWDHITRIKKPVIAAVNGYALGGGCELAMM 118
Query: 187 CDLTIAADNAIFGQTGPKVGSFDAGYGSSIMSRLV 221
CD+ A + A FGQ +G+ G+ ++R V
Sbjct: 119 CDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAV 153
|
| >d1q52a_ c.14.1.3 (A:) Naphthoate synthase MenB {Mycobacterium tuberculosis [TaxId: 1773]} Length = 297 | Back information, alignment and structure |
|---|
| >d1dcia_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 275 | Back information, alignment and structure |
|---|
| >d1uiya_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Thermus thermophilus [TaxId: 274]} Length = 253 | Back information, alignment and structure |
|---|
| >d1nzya_ c.14.1.3 (A:) 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., strain CBS-3 [TaxId: 306]} Length = 269 | Back information, alignment and structure |
|---|
| >d2f6qa1 c.14.1.3 (A:108-352) Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human (Homo sapiens) [TaxId: 9606]} Length = 245 | Back information, alignment and structure |
|---|
| >d1hzda_ c.14.1.3 (A:) AUH protein {Human (Homo sapiens) [TaxId: 9606]} Length = 266 | Back information, alignment and structure |
|---|
| >d1wdka4 c.14.1.3 (A:1-310) Fatty oxidation complex alpha subunit, N-terminal domain {Pseudomonas fragi [TaxId: 296]} Length = 310 | Back information, alignment and structure |
|---|
| >d1ef8a_ c.14.1.3 (A:) Methylmalonyl CoA decarboxylase {Escherichia coli [TaxId: 562]} Length = 261 | Back information, alignment and structure |
|---|
| >d1pjha_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 266 | Back information, alignment and structure |
|---|
| >d1szoa_ c.14.1.3 (A:) 6-oxo camphor hydrolase {Rhodococcus erythropolis [TaxId: 1833]} Length = 249 | Back information, alignment and structure |
|---|
| >d1wz8a1 c.14.1.3 (A:2-264) Probable enoyl-CoA hydratase TTHA0218 {Thermus thermophilus [TaxId: 274]} Length = 263 | Back information, alignment and structure |
|---|
| >d2fw2a1 c.14.1.3 (A:3-260) Chromodomain protein CDY2A {Human (Homo sapiens) [TaxId: 9606]} Length = 258 | Back information, alignment and structure |
|---|
| >d2a7ka1 c.14.1.3 (A:1-230) Carbapenem biosynthes protein CarB {Pectobacterium carotovorum [TaxId: 554]} Length = 230 | Back information, alignment and structure |
|---|
| >d1sg4a1 c.14.1.3 (A:2-250) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Length = 249 | Back information, alignment and structure |
|---|
| >d1uyra1 c.14.1.4 (A:1482-1814) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 333 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 240 | |||
| d1mj3a_ | 260 | Enoyl-CoA hydratase (crotonase) {Rat (Rattus norve | 100.0 | |
| d1pjha_ | 266 | Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso | 100.0 | |
| d2a7ka1 | 230 | Carbapenem biosynthes protein CarB {Pectobacterium | 100.0 | |
| d2f6qa1 | 245 | Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human ( | 100.0 | |
| d1wdka4 | 310 | Fatty oxidation complex alpha subunit, N-terminal | 100.0 | |
| d1hzda_ | 266 | AUH protein {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1sg4a1 | 249 | Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso | 100.0 | |
| d2fw2a1 | 258 | Chromodomain protein CDY2A {Human (Homo sapiens) [ | 100.0 | |
| d1nzya_ | 269 | 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., | 100.0 | |
| d1q52a_ | 297 | Naphthoate synthase MenB {Mycobacterium tuberculos | 100.0 | |
| d1wz8a1 | 263 | Probable enoyl-CoA hydratase TTHA0218 {Thermus the | 100.0 | |
| d1ef8a_ | 261 | Methylmalonyl CoA decarboxylase {Escherichia coli | 100.0 | |
| d1uiya_ | 253 | Enoyl-CoA hydratase (crotonase) {Thermus thermophi | 100.0 | |
| d1dcia_ | 275 | Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso | 100.0 | |
| d1szoa_ | 249 | 6-oxo camphor hydrolase {Rhodococcus erythropolis | 100.0 | |
| d1on3a1 | 253 | Methylmalonyl-CoA carboxyltransferase (transcarbox | 97.09 | |
| d2f9yb1 | 263 | Acetyl-coenzyme A carboxylase carboxyl transferase | 96.63 | |
| d1xnya1 | 258 | Propionyl-CoA carboxylase complex B subunit, PccB | 96.62 | |
| d2a7sa1 | 258 | Propionyl-CoA carboxylase complex B subunit, PccB | 96.59 | |
| d1yg6a1 | 183 | Clp protease, ClpP subunit {Escherichia coli [TaxI | 96.46 | |
| d1pixa2 | 287 | Glutaconyl-CoA decarboxylase A subunit {Acidaminoc | 96.39 | |
| d1vrga1 | 251 | Propionyl-CoA carboxylase complex B subunit, PccB | 96.24 | |
| d2cbya1 | 179 | Clp protease, ClpP subunit {Mycobacterium tubercul | 95.86 | |
| d1uyra1 | 333 | Acetyl-coenzyme A carboxylase {Baker's yeast (Sacc | 94.97 | |
| d2f9ya1 | 316 | Acetyl-coenzyme A carboxylase carboxyl transferase | 94.96 | |
| d1y7oa1 | 192 | Clp protease, ClpP subunit {Streptococcus pneumoni | 94.66 | |
| d2f6ia1 | 190 | Clp protease, ClpP subunit {Plasmodium falciparum | 94.58 | |
| d2a7sa2 | 271 | Propionyl-CoA carboxylase complex B subunit, PccB | 94.52 | |
| d1tg6a1 | 193 | Clp protease, ClpP subunit {Human (Homo sapiens), | 94.23 | |
| d1vrga2 | 264 | Propionyl-CoA carboxylase complex B subunit, PccB | 94.16 | |
| d1xnya2 | 263 | Propionyl-CoA carboxylase complex B subunit, PccB | 93.8 | |
| d1on3a2 | 264 | Methylmalonyl-CoA carboxyltransferase (transcarbox | 93.2 | |
| d1pixa3 | 299 | Glutaconyl-CoA decarboxylase A subunit {Acidaminoc | 82.0 | |
| d1uyra2 | 404 | Acetyl-coenzyme A carboxylase {Baker's yeast (Sacc | 81.68 |
| >d1mj3a_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: ClpP/crotonase superfamily: ClpP/crotonase family: Crotonase-like domain: Enoyl-CoA hydratase (crotonase) species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=100.00 E-value=8.1e-44 Score=304.50 Aligned_cols=168 Identities=32% Similarity=0.457 Sum_probs=148.4
Q ss_pred cceeEEEEEEe-CCCEEEEEEcCCCCCCCCCHHHHHHHHHHHHHhhhCCCeeEEEEeeCCCCCcccCCCccccccCCccc
Q 026342 67 EFTDIIYEKAV-GEGIAKITINRPDRRNAFRPHTVKELIRAFNDARDDSSVGVIILTGKGTEAFCSGGDQALRTRDGYAD 145 (240)
Q Consensus 67 ~~~~v~~~~~~-~~~v~~Itlnrp~~~Nal~~~~~~~L~~~l~~~~~d~~v~vvVltg~g~~~FcaG~Dl~~~~~~~~~~ 145 (240)
+|+.|.+|+.. +++|++||||||+++|+||.+|+.+|.++|+.++.|+++++|||+|.| ++||+|+|++++......
T Consensus 2 ~~~~i~~e~~g~~~~I~~itlnrP~~~Nal~~~~~~~l~~~l~~~~~d~~v~~vvl~g~g-~~F~aG~Dl~~~~~~~~~- 79 (260)
T d1mj3a_ 2 NFQYIITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGE-KAFAAGADIKEMQNRTFQ- 79 (260)
T ss_dssp CCSSEEEEEESGGGCEEEEEECCGGGTTCBCHHHHHHHHHHHHHHHHCTTCCEEEEECCS-SEEECCBCHHHHTTCCHH-
T ss_pred CCeEEEEEEEcCCCCEEEEEEcCCCcCCCCCHHHHHHHHHHHHHHHhCCCcceEEEeccc-ccccccchhhhhhccchh-
Confidence 57889999841 368999999999999999999999999999999999999999999998 899999999876542211
Q ss_pred hhhhhhhhHHHHHHHHHcCCCcEEEEECchhchhhHHHhhhcCEEEEeCCcEEecccccccccCCCchHHHHHhhcCHHH
Q 026342 146 YENFGRLNVLDLQVQIRRLPKPVIAMVAGYAVGGGHVLHMVCDLTIAADNAIFGQTGPKVGSFDAGYGSSIMSRLVSTVQ 225 (240)
Q Consensus 146 ~~~~~~~~~~~l~~~i~~~~kP~IAav~G~a~GgG~~lal~~D~rias~~a~f~~pe~~~Gl~p~~g~~~~l~rlvG~~~ 225 (240)
.. ....+.+++..+.++|||+||+|||+|+|||++|+++||||||+++++|++||+++|++|+++++++|++++|.++
T Consensus 80 -~~-~~~~~~~~~~~~~~~~kPvIaav~G~a~GgG~~lal~~D~~ia~~~a~f~~pe~~~Gl~p~~~~~~~l~~~ig~~~ 157 (260)
T d1mj3a_ 80 -DC-YSGKFLSHWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSL 157 (260)
T ss_dssp -HH-HHC--CCGGGGGGGCSSCEEEEECSEEETHHHHHHHHSSEEEEETTCEEECGGGGGTCCCCSSTTTHHHHHHCHHH
T ss_pred -hh-hHHHHHHHHHHhccCCCeEEEEEcCeEeHHHHHHHHHCCEEEEcCCCEEECchhccCcCCcccHHHHHHHHhCHHH
Confidence 11 1112345567889999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHhcCCcccc
Q 026342 226 QCLWWGLKKHVKC 238 (240)
Q Consensus 226 a~ellltG~~i~A 238 (240)
|++|+++|++|+|
T Consensus 158 a~~l~l~g~~~~a 170 (260)
T d1mj3a_ 158 AMEMVLTGDRISA 170 (260)
T ss_dssp HHHHHHHCCCEEH
T ss_pred HHHHHHcCcccCc
Confidence 9999999999986
|
| >d1pjha_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2a7ka1 c.14.1.3 (A:1-230) Carbapenem biosynthes protein CarB {Pectobacterium carotovorum [TaxId: 554]} | Back information, alignment and structure |
|---|
| >d2f6qa1 c.14.1.3 (A:108-352) Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wdka4 c.14.1.3 (A:1-310) Fatty oxidation complex alpha subunit, N-terminal domain {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d1hzda_ c.14.1.3 (A:) AUH protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sg4a1 c.14.1.3 (A:2-250) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Human (Homo sapiens), mitochondrial [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fw2a1 c.14.1.3 (A:3-260) Chromodomain protein CDY2A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzya_ c.14.1.3 (A:) 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., strain CBS-3 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1q52a_ c.14.1.3 (A:) Naphthoate synthase MenB {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1wz8a1 c.14.1.3 (A:2-264) Probable enoyl-CoA hydratase TTHA0218 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ef8a_ c.14.1.3 (A:) Methylmalonyl CoA decarboxylase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uiya_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1dcia_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1szoa_ c.14.1.3 (A:) 6-oxo camphor hydrolase {Rhodococcus erythropolis [TaxId: 1833]} | Back information, alignment and structure |
|---|
| >d1on3a1 c.14.1.4 (A:8-260) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]} | Back information, alignment and structure |
|---|
| >d2f9yb1 c.14.1.4 (B:23-285) Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, AccD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xnya1 c.14.1.4 (A:10-267) Propionyl-CoA carboxylase complex B subunit, PccB {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d2a7sa1 c.14.1.4 (A:20-277) Propionyl-CoA carboxylase complex B subunit, PccB {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1yg6a1 c.14.1.1 (A:11-193) Clp protease, ClpP subunit {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pixa2 c.14.1.4 (A:1-287) Glutaconyl-CoA decarboxylase A subunit {Acidaminococcus fermentans [TaxId: 905]} | Back information, alignment and structure |
|---|
| >d1vrga1 c.14.1.4 (A:1-251) Propionyl-CoA carboxylase complex B subunit, PccB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2cbya1 c.14.1.1 (A:15-193) Clp protease, ClpP subunit {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1uyra1 c.14.1.4 (A:1482-1814) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2f9ya1 c.14.1.4 (A:4-319) Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha, AccA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1y7oa1 c.14.1.1 (A:2-193) Clp protease, ClpP subunit {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2f6ia1 c.14.1.1 (A:177-366) Clp protease, ClpP subunit {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2a7sa2 c.14.1.4 (A:278-548) Propionyl-CoA carboxylase complex B subunit, PccB {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1tg6a1 c.14.1.1 (A:1-193) Clp protease, ClpP subunit {Human (Homo sapiens), mitochondrial [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vrga2 c.14.1.4 (A:252-515) Propionyl-CoA carboxylase complex B subunit, PccB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1xnya2 c.14.1.4 (A:268-530) Propionyl-CoA carboxylase complex B subunit, PccB {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1on3a2 c.14.1.4 (A:261-524) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]} | Back information, alignment and structure |
|---|
| >d1pixa3 c.14.1.4 (A:288-586) Glutaconyl-CoA decarboxylase A subunit {Acidaminococcus fermentans [TaxId: 905]} | Back information, alignment and structure |
|---|
| >d1uyra2 c.14.1.4 (A:1815-2218) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|