Citrus Sinensis ID: 026354


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240
MSLLSDLLNLNLSESTDKIIAEYIWIGGSGMDMRSKARTLPGPVSDPSKLPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSHSDVVAEEPWYGIEQEYTLLQKDVKWPLGWPIGGYPGPQGPYYCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVMPGQWEFQVGPAVGISAGDQLWVARYILEDYRDCWSCAFFRSQANSG
cccHHHHHcccccccccEEEEEEEEEcccccccccccCCccccccccccccccccccccccccccccccEEEEEEEEECcccccccCEEEEEEECccccccccccHHHHHHHHHHcccccccccCECcEEEEEEEEEccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccEEECccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccc
*SLLSDLLNLNLSESTDKIIAEYIWIGGSGMDMRSKARTLPGPVSDPSKLPKWNYDGSS*****GEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSHSDVVAEEPWYGIEQEYTLLQKDVKWPLGWPIGGYPGPQGPYYCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVMPGQWEFQVGPAVGISAGDQLWVARYILEDYRDCWSCAFFRSQANS*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLLSDLLNLNLSESTDKIIAEYIWIGGSGMDMRSKARTLPGPVSDPSKLPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSHSDVVAEEPWYGIEQEYTLLQKDVKWPLGWPIGGYPGPQGPYYCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVMPGQWEFQVGPAVGISAGDQLWVARYILEDYRDCWSCAFFRSQANSG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glutamine synthetase cytosolic isozyme 1-1 High-affinity glutamine synthetase. May contribute to the homeostatic control of glutamine synthesis in roots.confidentQ56WN1
Glutamine synthetase cytosolic isozyme 2 confidentP51119
Glutamine synthetase cytosolic isozyme 1-1 High-affinity glutamine synthetase. May be a major component of the cytosolic glutamine synthetic pathway in leaf blades.probableP14656

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
6.-.-.-Ligases.probable
6.3.-.-Forming carbon-nitrogen bonds.probable
6.3.1.-Acid--ammonia (or amide) ligases (amide synthases).probable
6.3.1.2Glutamate--ammonia ligase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2D3A, chain A
Confidence level:very confident
Coverage over the Query: 3-238
View the alignment between query and template
View the model in PyMOL