Citrus Sinensis ID: 026375

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------24

MKNLDLFACVYPEGTHLMVPWFERPVIYDVRARPHLVESTSGSRDLQMVKIGLRVLTRPVADKLPTVYRALGENYNERVLPSIIHETLKAVVAQYNASQLITQRETVSREIRKILTERAANFNIALDDVSITSLTFGKEFTSAIEAKQVAAQEAERAKYIVEKAEQDKRSAIIRAQGEATSAQLIGQAIANNPAFITLRKIEAAREIAQTIAHSANKVFLNSDDLLLNLQEMKLEGAKK

ccccccccccccccCEEEccccccCEEEEEEEEEEECccccccccccEEEEEEEEEEECcccccHHHHHHHccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccCEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccccEEEEcccccccccHHHHHHcccc

MKNLDLFACVYPEGTHLMVPWFERPVIYDVRARPHLVESTSGSRDLQMVKIGLRVLTRPVADKLPTVYRALGENYNERVLPSIIHETLKAVVAQYNASQLITQRETVSREIRKILTERAANFNIALDDVSITSLTFGKEFTSAIEAKQVAA*****AKYIV**********IIR****ATSAQLIGQAIANNPAFITLRKIEAAREIAQTIAHSANKVFLNSDDLLLNL**********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MKNLDLFACVYPEGTHLMVPWFERPVIYDVRARPHLVESTSGSRDLQMVKIGLRVLTRPVADKLPTVYRALGENYNERVLPSIIHETLKAVVAQYNASQLITQRETVSREIRKILTERAANFNIALDDVSITSLTFGKEFTSAIEAxxxxxxxxxxxxxxxxxxxxxKRSAIIRAQGEATSAQLIGQAIANNPAFITLRKIEAAREIAQTIAHSANKVFLNSDDLLLNLQEMKLEGAKK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Prohibitin-1, mitochondrial	Prohibitin probably acts as a holdase/unfoldase for the stabilization of newly synthesized mitochondrial proteins.	probable	O49460
Prohibitin-2	Acts as a mediator of transcriptional repression by nuclear hormone receptors via recruitment of histone deacetylases. Functions as an estrogen receptor (ER)-selective coregulator that potentiates the inhibitory activities of antiestrogens and represses the activity of estrogens. Competes with NCOA1 for modulation of ER transcriptional activity. Probably involved in regulating mitochondrial respiration activity and in aging.	probable	A9UMS3
Prohibitin-2	Prohibitin probably acts as a holdase/unfoldase for the stabilization of newly synthesized mitochondrial proteins.	probable	O94550

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BK6, chain A
Confidence level:very confident
Coverage over the Query: 21-148,163-203
View the alignment between query and template
View the model in PyMOL