Citrus Sinensis ID: 026386

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------24
MALQICLALSISSHNSLNHSPMSSSPSTLISFSVQTKKKTVVELSSLRLSKRELCLSSFVLILNGLYPKLSKASLPEEMELQRYTDSNEGFTLLRPSSWIKVDKAGATVLFEEANKGTNNLGVVVNPVRVASLGEFGTPQFVADKLIQAEKRKESTIDTELIGASERSGHGGLKVYEFEYKVDSSRGGLKRIFSAAFVASKKLYLLNITHSDKPESPLDTHTRMMLEEVLHSFDAAPTT
ccccccHHHcccccccccccccccccccccEEEEEccccccHHccccHHHHHHHHHHHHHHHHHHccccccccccccccccCEEEcccccEEEEcccccEEcccccccEEEEccccccccEEEEECccccccccccccHHHHHHHHHHHHHcccccccEEEEEcCEEECcccEEEEEEEEEEEccccccEEEEEEEEEEccEEEEEEEECcccccccccHHHHHHHHHHHccCCccccc
****ICLA*****************************KKTVVELSSLRLSKRELCLSSFVLILNGLYPKLSKASLPEEMELQRYTDSNEGFTLLRPSSWIKVDKAGATVLFEEANKGTNNLGVVVNPVRVASLGEFGTPQFVADKLIQAEK*********LI******GHGGLKVYEFEYKVDSSRGGLKRIFSAAFVASKKLYLLNITHSDKPES***THTRMMLEEVLHSFDAAP**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALQICLALSISSHNSLNHSPMSSSPSTLISFSVQTKKKTVVELSSLRLSKRELCLSSFVLILNGLYPKLSKASLPEEMELQRYTDSNEGFTLLRPSSWIKVDKAGATVLFEEANKGTNNLGVVVNPVRVASLGEFGTPQFVADKLIQAEKRKESTIDTELIGASERSGHGGLKVYEFEYKVDSSRGGLKRIFSAAFVASKKLYLLNITHSDKPESPLDTHTRMMLEEVLHSFDAAPTT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
PsbP domain-containing protein 2, chloroplastic probableQ8VY52

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XB3, chain A
Confidence level:very confident
Coverage over the Query: 79-236
View the alignment between query and template
View the model in PyMOL
Template: 2VU4, chain A
Confidence level:probable
Coverage over the Query: 81-236
View the alignment between query and template
View the model in PyMOL