Citrus Sinensis ID: 026388


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------24
MTDPNLYLQESGWEELRKEARKIEGDLDVKLSSYAKLGARFTQGGYVDTGSPTVGSGRSWKSMEMEIQSLLEKLLDINDAMSRCAASAAPTTSVTQKLARHRDILHEFTQEFRRIKGNINSMREHAELLSSVRDDISEYKASGSMSPRMQILRERAAIHGSITHIDDVISQAQTTRTVLGSQRALFGDVQGKVKVLSDKFPIIRGLLGSIRRRRSRDTLILAAVIAGCTLFLIIYWLSK
ccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHcc
*************EELRKEARKIEGDLDVKLSSYAKLGAR*************************EIQSLLEKLLDINDAMSRC**************ARHRDILHEFTQEFRRIKGN********************************ILRERAAIHGSITHIDDVISQAQTTRTVLGSQRALFGDVQGKVKVLSDKFPIIRGLLGSIRRRRSRDTLILAAVIAGCTLFLIIYWLSK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTDPNLYLQESGWEELRKEARKIEGDLDVKLSSYAKLGARFTQGGYVDTGSPTVGSGRSWKSMEMEIQSLLEKLLDINDAMSRCAASAAPTTSVTQKLARHRDILHEFTQEFRRIKGNINSMREHAELLSSVRDDISEYKASGSMSPRMQILRERAAIHGSITHIDDVISQAQTTRTVLGSQRALFGDVQGKVKVLSDKFPIIRGLLGSIRRRRSRDTLILAAVIAGCTLFLIIYWLSK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Golgi SNAP receptor complex member 1 Involved in transport from the ER to the Golgi apparatus as well as in intra-Golgi transport. It belongs to a super-family of proteins called t-SNAREs or soluble NSF (N-ethylmaleimide-sensitive factor) attachment protein receptor. Cooperates with ykt-6 for proper expression of Golgi-resident proteins. Required along with ykt-6 for normal embryonic development, seam cell division or differentiation, and ray formation.probableQ95ZW1
Golgi SNAP receptor complex member 1 Involved in transport from the ER to the Golgi apparatus as well as in intra-Golgi transport. It belongs to a super-family of proteins called t-SNAREs or soluble NSF (N-ethylmaleimide-sensitive factor) attachment protein receptor. May play a protective role against hydrogen peroxide induced cytotoxicity under glutathione depleted conditions in neuronal cells by regulating the intracellular ROS levels via inhibition of p38 MAPK (MAPK11, MAPK12, MAPK13 and MAPK14). Participates in docking and fusion stage of ER to cis-Golgi transport. Plays an important physiological role in VLDL-transport vesicle-Golgi fusion and thus in VLDL delivery to the hepatic cis-Golgi.probableQ5RBL6
Golgi SNAP receptor complex member 1 Involved in transport from the ER to the Golgi apparatus as well as in intra-Golgi transport. It belongs to a super-family of proteins called t-SNAREs or soluble NSF (N-ethylmaleimide-sensitive factor) attachment protein receptor.probableQ9VE50

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2QYW, chain A
Confidence level:probable
Coverage over the Query: 10-38,56-112
View the alignment between query and template
View the model in PyMOL
Template: 2KOG, chain A
Confidence level:probable
Coverage over the Query: 153-218
View the alignment between query and template
View the model in PyMOL