Citrus Sinensis ID: 026399

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------24
MSSQIVRSASRAATARSLLSASKNSRFYSEGRAVSAAAAVTFSGKLPYLVSSFGRAGSSTASRSWLSGAIAIPAAAYTLQEQEVHAAEMERTFIAIKPDGVQRGLISEIISRFERKGFKLVAIKIVVPSKEFAQKHYHDLKERPFFNGLCEFLSSGPVIAMVWEGEGVITYGRKLIGATDPQKSEPGTIRGDLAVVVGRNIIHGSDGPETAKDEIKLWFKPEDLVNYTSNAEKWVYESN
ccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEccccccccHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHHcccccccHHHHHHHccccEEEEEEEcccHHHHHHHHHccccccccccccccccccccccccCEEccccHHHHHHHHHccccccccccccccccccEEccc
*********************************VSAAA********PY**************RSWLSGAIAIPAAAYTLQEQEVHAAEMERTFIAIKPDGVQRGLISEIISRFERKGFKLVAIKIVVPSKEFAQKHYHDLKERPFFNGLCEFLSSGPVIAMVWEGEGVITYGRKLIGATDPQKSEPGTIRGDLAVVVGRNIIHGSDGPETAKDEIKLWFKPEDLVNYTSNAEKWVYES*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSQIVRSASRAATARSLLSASKNSRFYSEGRAVSAAAAVTFSGKLPYLVSSFGRAGSSTASRSWLSGAIAIPAAAYTLQEQEVHAAEMERTFIAIKPDGVQRGLISEIISRFERKGFKLVAIKIVVPSKEFAQKHYHDLKERPFFNGLCEFLSSGPVIAMVWEGEGVITYGRKLIGATDPQKSEPGTIRGDLAVVVGRNIIHGSDGPETAKDEIKLWFKPEDLVNYTSNAEKWVYESN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Nucleoside diphosphate kinase IV, chloroplastic/mitochondrial Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Shows the highest specificity towards GDP.confidentQ8LAH8
Nucleoside diphosphate kinase 4, chloroplastic Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Shows the highest specificity towards GDP.probableQ8RXA8
Nucleoside diphosphate kinase Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate.probableQ46I11

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.4.-2,7,4'-trihydroxyisoflavanone 4'-O-methyltransferase.probable
2.7.4.6Nucleoside-diphosphate kinase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1W7W, chain A
Confidence level:very confident
Coverage over the Query: 87-237
View the alignment between query and template
View the model in PyMOL